DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and pbs-2

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:243 Identity:90/243 - (37%)
Similarity:139/243 - (57%) Gaps:7/243 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQA 88
            |.|.||:||:.:.:.|.:.|...:||||:|.:.|.||:::||:||||:|.|:..|.|.|:.:|..
 Worm    21 FDFSNCIRNQAMCKMGGKAPKLTSTGTTIVAVAFKGGLVMGADSRATAGNIIADKHCEKVHKLTE 85

  Fly    89 NIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNGNIDADMIIGGA 153
            :|:|.|||||.|...:.::....|.|..:||| ||..|..|.:..:|.||.:.|.|.|.::|||.
 Worm    86 SIYACGAGTAADLDQVTKMLSGNLRLLELNTG-RKARVITALRQAKQHLFNYQGYIGAYLLIGGV 149

  Fly   154 DNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLC 218
            |.||.||:...::|:|...|||:.|||...:::|||..:..|::::.|..|...|:.|||..|..
 Worm   150 DPTGPHLYMCSANGTTMAFPFTAQGSGSYAAITILERDFKVDMTKDEAEKLVQRALEAGMHGDNA 214

  Fly   219 SGGKVSLCVVRCDFSV----QWPEQLPRQVPPTRTYRLSPKPGRTTIL 262
            ||..::|.::....:|    ..||...|..|....|:.  :.|.|.:|
 Worm   215 SGNSLNLVIIEPSETVFKGPIVPEFCKRPEPNDLVYKF--QAGATKVL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 81/203 (40%)
proteasome_beta_type_7 50..239 CDD:239732 73/192 (38%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 73/185 (39%)
proteasome_beta_type_7 47..235 CDD:239732 72/188 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157340
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S457
OMA 1 1.010 - - QHG53608
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 1 1.000 - - otm14620
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.