DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and PSMA8

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_653263.2 Gene:PSMA8 / 143471 HGNCID:22985 Length:256 Species:Homo sapiens


Alignment Length:235 Identity:55/235 - (23%)
Similarity:98/235 - (41%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFS 77
            ||:..:..|.|..|......:.:|:           |:|.|||.....|::|.|.::.: .:...
Human     6 DRAITVFSPDGHLFQVEYAQEAVKK-----------GSTAVGIRGTNIVVLGVEKKSVA-KLQDE 58

  Fly    78 KTCRKIIELQANIFAAGA------GTARDTKALVELTRAQLELHRMNTGFRKVPVCCAN-----Q 131
            :|.|||..|..::..|.|      |...|.:.::...|.:.:.|::..   :.||....     .
Human    59 RTVRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTV---EDPVTVEYITRFIA 120

  Fly   132 MIRQLLFRFNG----NIDADMIIGGADNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRW 192
            .::|...:.||    .|.| :|:|..|:..:.|:.|...|:.......:||...:.....||..:
Human   121 TLKQKYTQSNGRRPFGISA-LIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNY 184

  Fly   193 SED--LSEESACALACDAVAAGMKNDLCSGGK-VSLCVVR 229
            :||  .|:..|..||..|:...::    |||| :.|.::|
Human   185 TEDAIASDSEAIKLAIKALLEVVQ----SGGKNIELAIIR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 54/232 (23%)
proteasome_beta_type_7 50..239 CDD:239732 48/198 (24%)
PSMA8NP_653263.2 PRK03996 5..237 CDD:235192 55/235 (23%)
proteasome_alpha_type_7 5..219 CDD:239724 54/232 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.