DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosbeta3

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_003435908.2 Gene:Prosbeta3 / 1281478 VectorBaseID:AGAMI1_007064 Length:242 Species:Anopheles gambiae


Alignment Length:115 Identity:26/115 - (22%)
Similarity:39/115 - (33%) Gaps:36/115 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LYATGTSALNCYQCNGWHGDYP-LRYSTAATCDNRNDQCQTTQYCVKI-IDPMSPGVNYVTFKSD 73
            :||.|:.:...|.        | |||.....  .||...:|.|....: ||.:...:|...||  
Mosquito   317 MYALGSPSSEFYA--------PLLRYGVDPA--RRNFVSKTAQKAFDMRIDDLEKRINNTDFK-- 369

  Fly    74 CFYQTQIQVNPTNLSYIQGKTCFPYQDGSAPVKRWYYCFCNDRDYCNTAN 123
            |.::                   ..:|.|.|.|   |....:|::|...|
Mosquito   370 CPFR-------------------KLKDWSKPKK---YDKEYERNFCKEDN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 16/75 (21%)
Prosbeta3XP_003435908.2 None

Return to query results.
Submit another query.