DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and Prosbeta4

DIOPT Version :10

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_319581.4 Gene:Prosbeta4 / 1279804 VectorBaseID:AGAMI1_012350 Length:205 Species:Anopheles gambiae


Alignment Length:106 Identity:26/106 - (24%)
Similarity:44/106 - (41%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELH 115
            |::||.....|::.|:.......:|......||:::..|:..|..|.|.|.....|.....:.|:
Mosquito     3 TLMGIRGPDFVMLAADCTHAHSIMVLKDDEDKILKVSDNLMLATMGEAGDRVQFTEYISKNILLY 67

  Fly   116 RMNTGFRKVPVCCANQMIRQL--LFRFNGNIDADMIIGGAD 154
            ||..|:...|...|:...|.|  ..|.......::::||.|
Mosquito    68 RMRNGYELGPKAAAHFTRRNLADYLRSRTPYHVNLLVGGYD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 proteasome_beta_type_7 50..239 CDD:239732 26/106 (25%)
Prosbeta4XP_319581.4 None

Return to query results.
Submit another query.