DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and psmb11

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002941563.2 Gene:psmb11 / 100489702 XenbaseID:XB-GENE-6046332 Length:277 Species:Xenopus tropicalis


Alignment Length:223 Identity:56/223 - (25%)
Similarity:107/223 - (47%) Gaps:17/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALV 105
            |.|.....|||.:..::.|||:...::|:::|.:|.|...||...:.:::.|..:|::.|.:...
 Frog    51 EGPPPPAHGTTTLAFIYSGGVVAATDTRSSAGHLVCSPDSRKATLIHSHLLATTSGSSADCQLFG 115

  Fly   106 ELTRAQLELHRMNTGFRKVP-VCCANQMIRQLLFRFNG-NIDADMIIGGADNTGAHLFCTRSDGS 168
            .....:..::::..|:  :| |..|.:|:..::..|.| .:.|...:.|.|..|..:....:||:
 Frog   116 RALARECRIYQLRNGY--MPSVRGAAKMLSMIMMPFRGMKVCAAFTLCGWDRNGPCICYVYNDGT 178

  Fly   169 -TDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGGKVSLCVVR--- 229
             ..::...|:|||...:.||::..:...:.||.|..||..||....:.|..|||.|.:..:|   
 Frog   179 RISSSNVISVGSGSPYAYSIIDDGYRVGMGEEEARKLARRAVCHAGRRDAYSGGSVDVYWIREGG 243

  Fly   230 CDFS-----VQWPEQLPRQVPPTRTYRL 252
            |:..     ||..|:|.::    .|::|
 Frog   244 CERDAREDLVQLYEKLVQE----ETHKL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 48/189 (25%)
proteasome_beta_type_7 50..239 CDD:239732 49/199 (25%)
psmb11XP_002941563.2 Ntn_hydrolase 60..246 CDD:412394 47/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.