DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and psmb7.2

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002941310.2 Gene:psmb7.2 / 100489016 XenbaseID:XB-GENE-479691 Length:279 Species:Xenopus tropicalis


Alignment Length:228 Identity:94/228 - (41%)
Similarity:137/228 - (60%) Gaps:11/228 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPTLMKYPDRSPFLCGPSGFTFDNCLRNKQLKEN----GLEEPNSFTTGTTVVGIVFDGGVIIGA 65
            ||||..|  ..|  ||  ||:|:||.||..|:|.    ||:.|.:..||||:.||::..|||:||
 Frog     2 LPTLSVY--EPP--CG--GFSFENCPRNTFLEEQGPKLGLQPPKARKTGTTIAGIIYKDGVILGA 60

  Fly    66 ESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCAN 130
            :.|||...:|..|.|.||..:..||:..|||.|.|.:.:.:|..:.|.:|.|.|| |:..||.||
 Frog    61 DRRATDDMVVADKNCAKIHYITDNIYCCGAGVAADAENVTQLLSSNLHIHAMTTG-RQPRVCTAN 124

  Fly   131 QMIRQLLFRFNGNIDADMIIGGADNTGAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSED 195
            ::::|.|:|:.|:|.|.:|:||.|..|..|:.....||||..|||::|||...::::||.|:..:
 Frog   125 RILKQFLYRYQGHIGASIIVGGVDIKGPQLYSIYPHGSTDRVPFTALGSGSAAAIAVLEDRFKPN 189

  Fly   196 LSEESACALACDAVAAGMKNDLCSGGKVSLCVV 228
            :..|....|..:|:.||:..||.||..|.||::
 Frog   190 MELEEGKRLVTEAITAGIMCDLGSGSGVDLCII 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 90/222 (41%)
proteasome_beta_type_7 50..239 CDD:239732 72/179 (40%)
psmb7.2XP_002941310.2 proteasome_beta_type_7 45..233 CDD:239732 72/179 (40%)
Pr_beta_C 239..270 CDD:372128
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D415498at33208
OrthoFinder 1 1.000 - - FOG0001188
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.