DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and psmb5

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002941560.1 Gene:psmb5 / 100379732 XenbaseID:XB-GENE-975048 Length:257 Species:Xenopus tropicalis


Alignment Length:195 Identity:55/195 - (28%)
Similarity:96/195 - (49%) Gaps:3/195 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GLEEPN-SFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTK 102
            |..||. .|..|||.:...|..|||:..:||||:|..:.|:|.:|:||:...:....||.|.|..
 Frog    42 GAAEPGIEFLHGTTTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCS 106

  Fly   103 ALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLFRFNG-NIDADMIIGGADNTGAHLFCTRSD 166
            ....|...|..::.:... .::.|..|::::..:::::.| .:....:|.|.|..|..|:...|:
 Frog   107 FWERLLARQCRIYELRNK-ERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSE 170

  Fly   167 GSTDTAPFTSIGSGYQVSMSILESRWSEDLSEESACALACDAVAAGMKNDLCSGGKVSLCVVRCD 231
            |:..:....|:|||...:..:|:..::.::..|.|..||..::......|..|||.|:|..||.|
 Frog   171 GNRVSGSVFSVGSGSMYAYGVLDRGYNYEMEVEEAQELARRSIYQATYRDAYSGGVVNLYHVRED 235

  Fly   232  231
             Frog   236  235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 52/190 (27%)
proteasome_beta_type_7 50..239 CDD:239732 50/183 (27%)
psmb5XP_002941560.1 proteasome_beta_type_5 54..241 CDD:239730 50/183 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.