DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta2R2 and psmb11b

DIOPT Version :9

Sequence 1:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001268731.1 Gene:psmb11b / 100331481 ZFINID:ZDB-GENE-170530-2 Length:362 Species:Danio rerio


Alignment Length:226 Identity:57/226 - (25%)
Similarity:91/226 - (40%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFSKTCRKIIELQANIFAAGAGTARDTKALVEL 107
            |.:.:.|||.:|..|.||||..|::|::..|.|......|::.:.:::....:||:.|......:
Zfish   103 PFTLSHGTTTLGFAFQGGVIAAADTRSSCAGKVACPASPKVLPIHSHLVGTTSGTSADCALWKRI 167

  Fly   108 TRAQLELH------RMNTG------------FRKVPVCCANQMIRQLLFRFNGNIDAD----MII 150
            ...:|.|:      |::||            |:...:|.|     ..|..::|:.|.|    |..
Zfish   168 LARELRLYQLRHRRRLSTGGAAKLLSHMLHPFKGTELCVA-----ATLCGWDGDEDQDNEQPMTE 227

  Fly   151 GGADNT-------------------GAHLFCTRSDGSTDTAPFTSIGSGYQVSMSILES--RWSE 194
            ..|:.|                   |..:....|||........|:|||...:.|||:.  ||. 
Zfish   228 RYANTTLTSKSSSQSAASSGLSGVRGPRVVYVCSDGLRLQGALFSVGSGSPYAYSILDGGVRWG- 291

  Fly   195 DLSEESACALACDAVAAGMKNDLCSGGKVSL 225
             :|.:.|.|:|.:||......|..||..|.|
Zfish   292 -MSAQEAAAVAREAVYRATYRDAYSGNNVDL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 57/226 (25%)
proteasome_beta_type_7 50..239 CDD:239732 55/219 (25%)
psmb11bNP_001268731.1 proteasome_beta_type_5 110..333 CDD:239730 55/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.