DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Igsf9

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001139272.1 Gene:Igsf9 / 93842 MGIID:2135283 Length:1179 Species:Mus musculus


Alignment Length:265 Identity:62/265 - (23%)
Similarity:94/265 - (35%) Gaps:99/265 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 QAGQHAYLPCKLNQHSGKP----LSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271
            :||:.|.|.|.|...:|.|    :.|:                   ||..|     |...:..|.
Mouse    32 RAGESAVLGCDLLPPAGHPPLHVIEWL-------------------RFGFL-----LPIFIQFGL 72

  Fly   272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAK---- 332
            .|....|...           |:.|..:.:   :|||:.:.:||.|||||::....:.|.:    
Mouse    73 YSPRIDPDYV-----------GRVRLQTGA---SLQIEGLRVEDQGWYECRVLFLDQHSPEQDFA 123

  Fly   333 ----VQLFVITP-----RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFW-YRGDQ------ 381
                |.|.|.:|     ...|:.:    ||....|.|.|:.||:.:  .|:.| :||..      
Mouse   124 NGSWVHLTVNSPPQFQETPPLVLE----VKELEAVTLRCVARGSPQ--PYVTWKFRGQDLGKGQG 182

  Fly   382 QVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCE---PENSAAASM 443
            ||..:|                            |:|.|..|.:..:|:|||:   .|.|...:.
Mouse   183 QVQVQN----------------------------GTLWIRRVERGSAGDYTCQASSSEGSITHAT 219

  Fly   444 QLHVL 448
            ||.||
Mouse   220 QLLVL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 31/137 (23%)
Ig <298..338 CDD:299845 13/47 (28%)
IG_like 352..447 CDD:214653 26/104 (25%)
Ig 358..439 CDD:143165 21/90 (23%)
Igsf9NP_001139272.1 IG_like 28..110 CDD:214653 28/115 (24%)
Ig 136..223 CDD:386229 27/120 (23%)
Ig_3 227..305 CDD:372822
Ig 341..404 CDD:386229
Ig 436..500 CDD:319273
FN3 508..599 CDD:238020
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..807
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..842
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..974
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1079
PDZ-binding 1177..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.