DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr21

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:280 Identity:73/280 - (26%)
Similarity:119/280 - (42%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271
            |.|...|...:|.|::.....|.:||:|.||.|::.|..:|:.:|.||.|:.             
  Fly    60 NVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIY------------- 111

  Fly   272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLF 336
                                      |..:..|:||||:..|.|:|.||||::|.|.:...:...
  Fly   112 --------------------------NKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFS 150

  Fly   337 VITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQID 401
            |:.|.|.::|..:.::..||.|.|.|:::...:.|..:.|...:|::..::...|          
  Fly   151 VVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGG---------- 205

  Fly   402 RNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAARPHR 466
              :...||....|...|:|.......||.|||.|.|:.:.|:.:|:|.|::.|:..||     |.
  Fly   206 --VSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKS-----HL 263

  Fly   467 LGHGYTSLHQWLIFLLVALN 486
            |.....|    |.||.:.||
  Fly   264 LVSELLS----LCFLQICLN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 33/129 (26%)
Ig <298..338 CDD:299845 15/39 (38%)
IG_like 352..447 CDD:214653 22/94 (23%)
Ig 358..439 CDD:143165 19/80 (24%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 30/116 (26%)
IG_like 71..140 CDD:214653 28/107 (26%)
IG_like 162..249 CDD:214653 22/98 (22%)
IGc2 169..242 CDD:197706 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.