DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Trav12-3

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_008768928.3 Gene:Trav12-3 / 691058 RGDID:1564212 Length:132 Species:Rattus norvegicus


Alignment Length:161 Identity:27/161 - (16%)
Similarity:48/161 - (29%) Gaps:64/161 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVR 234
            :|:...|:||.||                     .|.:.||..|....|.|..:..:.:..:|.|
  Rat    14 QLNGVSSQQKVQQ---------------------SPESLTVPEGAKTSLNCTFSSSASQYFAWYR 57

  Fly   235 ----LRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQE 295
                ...:.::::..|....:.||...|                                     
  Rat    58 QHPGKEPKELLSIFSTGEKEEGRFTIQL------------------------------------- 85

  Fly   296 RGNSSSLSWTLQIKYVNLEDAGWYECQLATE 326
              |::||...|.|:.....|:..|.|.::|:
  Rat    86 --NTASLHVFLHIRDSQPGDSALYLCAVSTQ 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 21/126 (17%)
Ig <298..338 CDD:299845 9/29 (31%)
IG_like 352..447 CDD:214653
Ig 358..439 CDD:143165
Trav12-3XP_008768928.3 Ig 24..118 CDD:416386 23/151 (15%)
FR1 24..46 CDD:409353 8/42 (19%)
Ig strand A 24..26 CDD:409353 0/1 (0%)
Ig strand A' 30..34 CDD:409353 1/3 (33%)
Ig strand B 37..46 CDD:409353 2/8 (25%)
CDR1 46..50 CDD:409353 0/3 (0%)
FR2 51..58 CDD:409353 1/6 (17%)
Ig strand C 52..59 CDD:409353 2/6 (33%)
CDR2 59..78 CDD:409353 1/18 (6%)
Ig strand C' 60..70 CDD:409353 0/9 (0%)
Ig Strand C' 74..78 CDD:409353 0/3 (0%)
FR3 81..113 CDD:409353 10/70 (14%)
Ig strand D 81..86 CDD:409353 2/43 (5%)
Ig strand E 91..97 CDD:409353 1/5 (20%)
Ig strand F 105..112 CDD:409353 2/6 (33%)
CDR3 114..118 CDD:409353 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.