DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and nitr3a

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_571727.1 Gene:nitr3a / 60649 ZFINID:ZDB-GENE-001106-8 Length:337 Species:Danio rerio


Alignment Length:272 Identity:53/272 - (19%)
Similarity:79/272 - (29%) Gaps:97/272 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PLNATVQAGQHAYLPC----------KLNQHSG--KPL--SWVRLRDEHIIAVDHTTFINDARFA 255
            || ...:.|....|||          ...:||.  |||  ::.....|.:  .....|.|..|| 
Zfish    28 PL-VVAELGSRVTLPCFHSDDYVTTVSWTKHSSGKKPLLIAYSDFNSERV--TYQNAFNNTNRF- 88

  Fly   256 SLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYE 320
                   ..|:.||                                 .:.|.|.::..||...|.
Zfish    89 -------FITIASG---------------------------------CYNLTILHLEKEDFANYY 113

  Fly   321 CQLATEPKMSAKVQLFVITPRTELI----------GDRQRFVKAGSRVELHCIVRGTLEAPKY-I 374
            |......::.......::...|:.|          .||   :..|..|.|.|.|...:.|..| :
Zfish   114 CVKDFLNRLMFGEGTILLRKETDRISSTSVIQQPVSDR---LHPGDSVTLQCSVSSHICAGHYRV 175

  Fly   375 FWY-----------------RGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIG--SLVI 420
            :|:                 |.||.:.:..::|..||..|:      ...||...:..|  ...:
Zfish   176 YWFKHSSGYSQPGIIYTHDNRSDQCLKSSEKSSFVQSCVYS------LSQTELTTSDAGVYYCAV 234

  Fly   421 PLVRKIHSGNYT 432
            ....|||.||.|
Zfish   235 DTCGKIHFGNGT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 25/145 (17%)
Ig <298..338 CDD:299845 6/39 (15%)
IG_like 352..447 CDD:214653 24/101 (24%)
Ig 358..439 CDD:143165 23/95 (24%)
nitr3aNP_571727.1 V-set 26..130 CDD:284989 25/145 (17%)
IG_like 27..132 CDD:214653 25/147 (17%)
V-set 145..250 CDD:284989 26/111 (23%)
IG_like 154..250 CDD:214653 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.