Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_938162.3 | Gene: | nitr1k / 60646 | ZFINID: | ZDB-GENE-001106-5 | Length: | 328 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 49/203 - (24%) |
---|---|---|---|
Similarity: | 77/203 - (37%) | Gaps: | 54/203 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 YVNL-------EDAGWYECQLATEPK--MSAKVQLFVITPRTELIGD---------RQRFVKA-- 354
Fly 355 -GSRVELHC-IVRGTLEAPKYIFWYRGDQQVTAENEASGAQSG-WYTQIDRN--IFGSTE-HNRN 413
Fly 414 TIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIK-STAARPHRLGHGYTSLHQW 477
Fly 478 LIFLLVAL 485 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 8/35 (23%) |
Ig | <298..338 | CDD:299845 | 8/36 (22%) | ||
IG_like | 352..447 | CDD:214653 | 27/102 (26%) | ||
Ig | 358..439 | CDD:143165 | 22/85 (26%) | ||
nitr1k | NP_938162.3 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1457433at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |