DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and nitr1c

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_938164.2 Gene:nitr1c / 60645 ZFINID:ZDB-GENE-001106-4 Length:328 Species:Danio rerio


Alignment Length:246 Identity:50/246 - (20%)
Similarity:86/246 - (34%) Gaps:68/246 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNS 299
            :|...|:.:..|.|.:..  ..::|..|:..:.:||.::.|..        |...||..:.....
Zfish     1 MRYYFIVLLSSTIFCSTG--FDVVQEDTVKIVEAGGDVNFTCI--------FPGHVPSTKAWFKQ 55

  Fly   300 SSLSWTLQI---------------------------KYVNL-------EDAGWYECQLATEPK-- 328
            :::...|||                           .|.||       .|:..|.|.::....  
Zfish    56 TTVGKYLQIVSLDLKKQLKWNSSFEKTNRFNVTKVDDYFNLTILKTKPSDSATYYCVVSAYETIG 120

  Fly   329 MSAKVQLFV---ITPR-TELIGDRQRFVKAGSRVELHC-IVRGTLEAPKYIFWYRGDQQVTAENE 388
            |.:..:|.|   .|.| |.|.......|..|..|.|.| |...:......::|::         :
Zfish   121 MGSATRLLVKDAATDRNTTLHQSLIETVDPGDSVNLQCSIFTESCAGDHSVYWFK---------Q 176

  Fly   389 ASGAQSG-WYTQIDRNIFGSTEHN-----RNTIGSLVIPLVRKIHSGNYTC 433
            :||...| .||:.:||  |..::|     ::.:.||....:.:..||.|.|
Zfish   177 SSGHPEGVLYTKGERN--GRCKNNTESQTQSCVYSLHKNNISRSDSGIYYC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 23/137 (17%)
Ig <298..338 CDD:299845 12/78 (15%)
IG_like 352..447 CDD:214653 22/89 (25%)
Ig 358..439 CDD:143165 20/83 (24%)
nitr1cNP_938164.2 V-set 23..129 CDD:311561 19/113 (17%)
V-set 147..244 CDD:311561 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.