DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and DIP-delta

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:264 Identity:54/264 - (20%)
Similarity:90/264 - (34%) Gaps:73/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 PRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQST 261
            ||....:|  |.||..|:.|.|||.:....|..::|:.:..:.|:.:.........|::......
  Fly    44 PRFAQPIP--NVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDN 106

  Fly   262 TLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATE 326
            |                                         |.|.:...:.:|.|:|.||:.|.
  Fly   107 T-----------------------------------------WLLHVNQAHQDDRGYYMCQVNTN 130

  Fly   327 PKMSAKVQLFVITPRTELIGDRQR-----FVKAGSRVELHCIVRGTLEAPKYIFWYRGD-QQVTA 385
            |.:|....|.|:.|...|  |.:.     .|:....:.:.|...| ..||| |.|.|.| :::..
  Fly   131 PMISQVGYLQVVVPPNIL--DIESTPSSVAVRENQNINMTCRADG-FPAPK-IIWRREDGEEIAV 191

  Fly   386 ENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLH-VLS 449
            |.:..      ....|.::...|:.:||.:|:             |.|...|....|:... :|.
  Fly   192 EKKKK------VLVYDADVLPLTKVSRNEMGA-------------YLCIATNGVPPSVSKRIILD 237

  Fly   450 GEYS 453
            .|:|
  Fly   238 VEFS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 24/131 (18%)
Ig <298..338 CDD:299845 11/39 (28%)
IG_like 352..447 CDD:214653 20/96 (21%)
Ig 358..439 CDD:143165 18/81 (22%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 26/134 (19%)
Ig 145..238 CDD:416386 23/115 (20%)
Ig strand A 145..149 CDD:409353 1/5 (20%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 3/5 (60%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/9 (0%)
Ig strand E 203..209 CDD:409353 0/5 (0%)
Ig strand F 216..223 CDD:409353 3/19 (16%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 54/264 (20%)
Ig strand A' 250..253 CDD:409353
Ig strand B 259..266 CDD:409353
Ig strand C 272..277 CDD:409353
Ig strand C' 281..283 CDD:409353
Ig strand D 289..293 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 314..322 CDD:409353
Ig strand G 325..334 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.