Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 264 | Identity: | 54/264 - (20%) |
---|---|---|---|
Similarity: | 90/264 - (34%) | Gaps: | 73/264 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 197 PRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQST 261
Fly 262 TLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATE 326
Fly 327 PKMSAKVQLFVITPRTELIGDRQR-----FVKAGSRVELHCIVRGTLEAPKYIFWYRGD-QQVTA 385
Fly 386 ENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLH-VLS 449
Fly 450 GEYS 453 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 24/131 (18%) |
Ig | <298..338 | CDD:299845 | 11/39 (28%) | ||
IG_like | 352..447 | CDD:214653 | 20/96 (21%) | ||
Ig | 358..439 | CDD:143165 | 18/81 (22%) | ||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 26/134 (19%) |
Ig | 145..238 | CDD:416386 | 23/115 (20%) | ||
Ig strand A | 145..149 | CDD:409353 | 1/5 (20%) | ||
Ig strand A' | 154..159 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 178..183 | CDD:409353 | 3/5 (60%) | ||
Ig strand C' | 185..187 | CDD:409353 | 1/1 (100%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/9 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/19 (16%) | ||
Ig strand G | 230..238 | CDD:409353 | 1/7 (14%) | ||
Ig | 242..333 | CDD:416386 | 54/264 (20%) | ||
Ig strand A' | 250..253 | CDD:409353 | |||
Ig strand B | 259..266 | CDD:409353 | |||
Ig strand C | 272..277 | CDD:409353 | |||
Ig strand C' | 281..283 | CDD:409353 | |||
Ig strand D | 289..293 | CDD:409353 | |||
Ig strand E | 295..305 | CDD:409353 | |||
Ig strand F | 314..322 | CDD:409353 | |||
Ig strand G | 325..334 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |