DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and CG34353

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:392 Identity:77/392 - (19%)
Similarity:120/392 - (30%) Gaps:164/392 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PLNATVQAGQHAY-LPC----KLNQHSGKPLSWVR-------LRDEHIIAVDHTTFI-------- 249
            |..::..:.:.|| ..|    |.|..:||..:..|       :||..:.::.|..|:        
  Fly     7 PTRSSSSSSRIAYKFECHSNSKQNSKTGKMAAEARTISKPGHIRDRRVGSLPHILFLAIAVVSLH 71

  Fly   250 ------------NDARFASLLQSTTLTT-------------------------LVSGGALSTTAT 277
                        |:..|.|..::....|                         :::.|::..|..
  Fly    72 FESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKRGIAILTAGSVKVTPD 136

  Fly   278 PVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLAT-EPKMSAKVQLFVITPR 341
            |...|.|.|                  .|||:.....|||.|.||:|| :|:........::.||
  Fly   137 PRVRLVNGF------------------NLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPR 183

  Fly   342 TELI---GDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYR-------GDQQV------------- 383
            ...|   |..|  ||.||.|.:.|...|. ..|. :.|.|       |::::             
  Fly   184 IHHISTGGHLQ--VKKGSSVRIECSATGN-PMPN-VTWSRKNNILPNGEEKLHSHVLSIENVDRH 244

  Fly   384 -------TAENEASGAQSG------------------------------------------WY-- 397
                   ||.|......|.                                          |:  
  Fly   245 KGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKD 309

  Fly   398 -TQIDRNIFGSTE-HNRNTIGSLVIPLVRKIHS---GNYTCEPENSAAASMQLHVLSGEYSASAI 457
             .|:|     :|| |...|.||....::||:|.   |||:|..||....:.:...|||:.:.:..
  Fly   310 TMQLD-----TTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVF 369

  Fly   458 KS 459
            .|
  Fly   370 NS 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 35/189 (19%)
Ig <298..338 CDD:299845 12/40 (30%)
IG_like 352..447 CDD:214653 33/170 (19%)
Ig 358..439 CDD:143165 29/156 (19%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 18/97 (19%)
Ig 103..177 CDD:143165 18/91 (20%)
IG_like 191..269 CDD:214653 17/81 (21%)
IGc2 198..258 CDD:197706 12/61 (20%)
I-set 273..360 CDD:254352 18/91 (20%)
Ig 290..359 CDD:143165 18/73 (25%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.