DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and robo4

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:425 Identity:89/425 - (20%)
Similarity:140/425 - (32%) Gaps:149/425 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PNEQSRLHAYDSEQKAQ-QLRREKELAKERELLPRR-------QLSLP-----PLNATVQAGQHA 216
            |:||.   |..||.|.. :.|...:.|..|:...||       :::||     |.:..|:.|..|
Zfish    27 PDEQV---AQRSEGKGHLRHRLMHQRASHRDRAHRRKGSRLVSEINLPRIVHHPSDVVVRVGSPA 88

  Fly   217 YLPCKLNQHSGKPLSWVR-----------LRDEHIIAVDHTTFI-----------NDARFASLLQ 259
            .|.|:...:....:.|:|           .:.:.|:..|.:.|.           ::|.:|.:..
Zfish    89 TLSCRAEGNPEPTIQWLRNGQPLDTDKMDAQSQPIVLPDGSLFFFSVVPGRKGQSHEAVYACIAH 153

  Fly   260 STTLTTLVSGGALSTTAT-PVAALGNSF-----------------------AHAVPGGQERG--- 297
            ::.      |.|.|..|: .:|||...|                       .|..|....|.   
Zfish   154 NSI------GNATSRNASLHIAALREDFRVQPSDVEVAIGEMATINCSPPVGHPEPNVTWRKDGI 212

  Fly   298 --NSSSLSWT-----LQIKYVNLEDAGWYEC----QLATEPKMSAKVQLF---VITPRTELIGDR 348
              |||:..:|     |.|......|:|.|.|    .:......:|::.:.   |:..:.|.:.  
Zfish   213 LINSSNEHYTELKGKLIIAPAQKNDSGVYSCIASNMIGVRESRAARLSVLAKPVLLRKPEDVS-- 275

  Fly   349 QRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRN 413
               |:.|...:..|...|  :....|.|.|         |.....:|.|       ..:.:|   
Zfish   276 ---VQLGESAQFFCEADG--DPMPSIEWSR---------EQGPLPNGRY-------LINPDH--- 316

  Fly   414 TIGSLVIPLVRKIHSGNYTCEPENS---AAASMQLHV----------LSGEYSA-------SAIK 458
               ||.|..|.....|.|:|..||.   :.||.||.|          |..|.||       ..:.
Zfish   317 ---SLQIHYVTAQDMGRYSCTVENKLGVSVASAQLLVEDAGGTRLRDLHKELSALRVSLENVTVM 378

  Fly   459 STA--------------ARPHRLGHGYTSLHQWLI 479
            |||              ::||.| .|:..|::.|:
Zfish   379 STASNMSQVMWKLQSFGSQPHYL-EGFEVLYRSLL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 35/194 (18%)
Ig <298..338 CDD:299845 11/51 (22%)
IG_like 352..447 CDD:214653 24/97 (25%)
Ig 358..439 CDD:143165 18/83 (22%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 19/104 (18%)
I-set 71..168 CDD:254352 18/102 (18%)
I-set 175..261 CDD:254352 15/85 (18%)
Ig2_Robo 177..261 CDD:143201 14/83 (17%)
I-set 265..350 CDD:254352 26/113 (23%)
Ig 282..350 CDD:299845 22/91 (24%)
FN3 373..448 CDD:214495 9/41 (22%)
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.