DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and nitr12

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001020667.1 Gene:nitr12 / 557932 ZFINID:ZDB-GENE-041001-1 Length:318 Species:Danio rerio


Alignment Length:158 Identity:39/158 - (24%)
Similarity:59/158 - (37%) Gaps:46/158 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 TVQAGQHAYLPCKLNQHSGKP----LSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSG 269
            :||..::.::   ||....||    :.:...||..:|...:..|:| .:.||..|. .:...:||
Zfish    86 SVQKEKNTFV---LNIKEAKPSDAGIYYCGARDYDLITFSNGLFLN-YKDASTKQH-HIKQFLSG 145

  Fly   270 GALSTTATPVAALGNS------------------------FAHAVPG-GQERGNSS--------- 300
            ..|.|...|....|:|                        |..|.|| ..:.||::         
Zfish   146 PNLGTEHEPEFNPGDSVNLHCSVLTERCEENHTIYWFRHEFGDAHPGLIYKDGNTTDQCEKRSEK 210

  Fly   301 ---SLSWTLQIKYVNLEDAGWYECQLAT 325
               |..:.|..|.:||.|||.|.|.:||
Zfish   211 DVQSCIYNLPKKNLNLTDAGVYYCAVAT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 39/158 (25%)
Ig <298..338 CDD:299845 13/40 (33%)
IG_like 352..447 CDD:214653
Ig 358..439 CDD:143165
nitr12NP_001020667.1 IgV 28..124 CDD:143167 9/40 (23%)
IG_like 30..123 CDD:214653 9/39 (23%)
V-set 150..253 CDD:284989 22/89 (25%)
IG_like 155..236 CDD:214653 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.