DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:294 Identity:73/294 - (24%)
Similarity:103/294 - (35%) Gaps:84/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 QLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLT 264
            :.|..|.:.||.|||.|.|||.|..:|| .:.|                             |..
Human    22 RFSQEPADQTVVAGQRAVLPCVLLNYSG-IVQW-----------------------------TKD 56

  Fly   265 TLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKM 329
            .|..|......|.|        .:.|.|..:.|     .:.|:|....|.|...|||| |||..:
Human    57 GLALGMGQGLKAWP--------RYRVVGSADAG-----QYNLEITDAELSDDASYECQ-ATEAAL 107

  Fly   330 -SAKVQLFVITP--RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYR-GDQQVTAENEAS 390
             |.:.:|.|:.|  .|.:.|.....::||:...|.|.......|.. |.|:| |.||       .
Human   108 RSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHNLTCRAFNAKPAAT-IIWFRDGTQQ-------E 164

  Fly   391 GAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAAS-------MQLH-- 446
            ||.:.  |::.::  |..|   .|:..|:|..........:||...|.|..|       :.:|  
Human   165 GAVAS--TELLKD--GKRE---TTVSQLLINPTDLDIGRVFTCRSMNEAIPSGKETSIELDVHHP 222

  Fly   447 -----------VLSGEYSASAIKSTAARPHRLGH 469
                       |..||......::| |.|..||:
Human   223 PTVTLSIEPQTVQEGERVVFTCQAT-ANPEILGY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 35/132 (27%)
Ig <298..338 CDD:299845 13/40 (33%)
IG_like 352..447 CDD:214653 25/115 (22%)
Ig 358..439 CDD:143165 20/81 (25%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 36/137 (26%)
Ig 25..116 CDD:299845 35/134 (26%)
Ig2_KIRREL3-like 138..219 CDD:143236 22/95 (23%)
I-set 223..304 CDD:254352 8/34 (24%)
Ig_2 227..305 CDD:290606 8/30 (27%)
Ig_2 311..405 CDD:290606
IG_like 314..405 CDD:214653
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.