DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Cadm1

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001297770.1 Gene:Cadm1 / 54725 MGIID:1889272 Length:474 Species:Mus musculus


Alignment Length:238 Identity:46/238 - (19%)
Similarity:85/238 - (35%) Gaps:67/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271
            :.||..|:.|.:.|::|:.....:..:....:.|...|... :.|:||..|              
Mouse    54 DVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRP-LKDSRFQLL-------------- 103

  Fly   272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLF 336
                                      |.||....:.:..|::.|.|.|.|||.|:|...:...:.
Mouse   104 --------------------------NFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTIT 142

  Fly   337 VITPRTELIGDRQRFVKA-GSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQI 400
            |:.|...|:.|.|:.... |..:|::|....:..|.. |.|::|::::..::|.. ..|..||  
Mouse   143 V
LVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATT-IRWFKGNKELKGKSEVE-EWSDMYT-- 203

  Fly   401 DRNIFGSTEHNRNTIGSLVIPLVRKIHSGN----YTCEPENSA 439
                             :...|:.|:|..:    ..|:.|:.|
Mouse   204 -----------------VTSQLMLKVHKEDDGVPVICQVEHPA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 24/129 (19%)
Ig <298..338 CDD:299845 12/39 (31%)
IG_like 352..447 CDD:214653 17/93 (18%)
Ig 358..439 CDD:143165 15/84 (18%)
Cadm1NP_001297770.1 Ig1_Necl-2 49..143 CDD:143289 24/129 (19%)
Ig2_Necl-2 164..245 CDD:143291 16/87 (18%)
IG_like 255..333 CDD:214653
4.1m 427..445 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5205
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.