Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001338930.1 | Gene: | NTM / 50863 | HGNCID: | 17941 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 364 | Identity: | 80/364 - (21%) |
---|---|---|---|
Similarity: | 122/364 - (33%) | Gaps: | 134/364 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271
Fly 272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATE--PKMSAKVQ 334
Fly 335 LFV-ITPR-TELIGDRQRFVKAGSRVELHCIVRG------------------------------- 366
Fly 367 -------------------------TLEAPKYIFWYRG-----DQQVTAENEASGAQSG---WYT 398
Fly 399 QIDRNIFGS---TEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAA---ASMQLHVLSGEYSAS-- 455
Fly 456 -AIKSTAARPHRLGHGYTSLHQ----------WLIFLLV 483 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 28/131 (21%) |
Ig | <298..338 | CDD:299845 | 13/42 (31%) | ||
IG_like | 352..447 | CDD:214653 | 34/164 (21%) | ||
Ig | 358..439 | CDD:143165 | 30/147 (20%) | ||
NTM | NP_001338930.1 | Ig | 44..132 | CDD:416386 | 28/131 (21%) |
Ig strand A' | 44..49 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 64..70 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/8 (13%) | ||
CDR2 | 71..83 | CDD:409353 | 1/11 (9%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 12/73 (16%) | ||
Ig strand D | 87..94 | CDD:409353 | 3/21 (14%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 5/9 (56%) | ||
FR4 | 125..132 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 136..205 | CDD:404760 | 8/70 (11%) | ||
Ig strand A' | 142..147 | CDD:409353 | 1/6 (17%) | ||
Ig strand B | 153..160 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 166..171 | CDD:409353 | 0/4 (0%) | ||
Ig strand D | 177..180 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 184..190 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 197..204 | CDD:409353 | 0/6 (0%) | ||
Ig strand G | 211..219 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 222..299 | CDD:404760 | 24/76 (32%) | ||
putative Ig strand A | 223..229 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 239..243 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 278..282 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 292..297 | CDD:409353 | 4/4 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |