DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and NTM

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:364 Identity:80/364 - (21%)
Similarity:122/364 - (33%) Gaps:134/364 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271
            |.||:.|:.|.|.|.::....: ::|  |....|:...:..:..|.|..               .
Human    44 NVTVRQGESATLRCTIDNRVTR-VAW--LNRSTILYAGNDKWCLDPRVV---------------L 90

  Fly   272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATE--PKMSAKVQ 334
            ||.|.|                         .::::|:.|::.|.|.|.|.:.|:  ||.| :|.
Human    91 LSNTQT-------------------------QYSIEIQNVDVYDEGPYTCSVQTDNHPKTS-RVH 129

  Fly   335 LFV-ITPR-TELIGDRQRFVKAGSRVELHCIVRG------------------------------- 366
            |.| ::|: .|:..|..  :..|:.:.|.||..|                               
Human   130 LIVQVSPKIVEISSDIS--INEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGIT 192

  Fly   367 -------------------------TLEAPKYIFWYRG-----DQQVTAENEASGAQSG---WYT 398
                                     |:..|.||...:|     .|:.|.:.|||...|.   ||.
Human   193 REQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYK 257

  Fly   399 QIDRNIFGS---TEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAA---ASMQLHVLSGEYSAS-- 455
            ...|.|.|.   ...||..:..|:...|.:...|||||...|...   ||:.|..|:...|::  
Human   258 DDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLL 322

  Fly   456 -AIKSTAARPHRLGHGYTSLHQ----------WLIFLLV 483
             .:|:||..|.: |.|..|...          ||:.|||
Human   323 QEVKTTALTPWK-GPGAVSEVSNGTSRRAGCVWLLPLLV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 28/131 (21%)
Ig <298..338 CDD:299845 13/42 (31%)
IG_like 352..447 CDD:214653 34/164 (21%)
Ig 358..439 CDD:143165 30/147 (20%)
NTMNP_001338930.1 Ig 44..132 CDD:416386 28/131 (21%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 1/8 (13%)
Ig strand C 64..70 CDD:409353 1/8 (13%)
CDR2 71..83 CDD:409353 1/11 (9%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 12/73 (16%)
Ig strand D 87..94 CDD:409353 3/21 (14%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 5/9 (56%)
FR4 125..132 CDD:409353 3/7 (43%)
Ig_3 136..205 CDD:404760 8/70 (11%)
Ig strand A' 142..147 CDD:409353 1/6 (17%)
Ig strand B 153..160 CDD:409353 3/6 (50%)
Ig strand C 166..171 CDD:409353 0/4 (0%)
Ig strand D 177..180 CDD:409353 0/2 (0%)
Ig strand E 184..190 CDD:409353 0/5 (0%)
Ig strand F 197..204 CDD:409353 0/6 (0%)
Ig strand G 211..219 CDD:409353 0/7 (0%)
Ig_3 222..299 CDD:404760 24/76 (32%)
putative Ig strand A 223..229 CDD:409353 2/5 (40%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.