DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr6

DIOPT Version :10

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:289 Identity:84/289 - (29%)
Similarity:123/289 - (42%) Gaps:70/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSG 269
            |.|.|...|:.|||.|::...:.|.:||:|.||.||:.|...|:.:|.||               
  Fly    80 PRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRF--------------- 129

  Fly   270 GALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQ 334
                                    |...:..:..||||||:....|||.||||::|:|..|..|:
  Fly   130 ------------------------QATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVR 170

  Fly   335 LFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQ 399
            |.|:.|...::|.....|..||.:.|.|.|:.:.|.|.|||||..::.:..::...|        
  Fly   171 LNVVVPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGG-------- 227

  Fly   400 IDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVL------SGEYSASAIK 458
                :...||....|...|:|.......||.|:|.|.|:..||:::|||      |||:      
  Fly   228 ----VSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEH------ 282

  Fly   459 STAARPHRLGHGYTSL-HQWL-IFLLVAL 485
                 |..:..|.:.. :.|| |.||:.|
  Fly   283 -----PEAMQTGSSGCQYNWLTIVLLLGL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 352..447 CDD:214653 27/94 (29%)
Ig strand B 358..362 CDD:409353 1/3 (33%)
Ig strand C 373..377 CDD:409353 3/3 (100%)
Ig strand E 416..420 CDD:409353 1/3 (33%)
Ig strand F 430..435 CDD:409353 2/4 (50%)
dpr6NP_001287018.1 FR1 79..96 CDD:409355 7/15 (47%)
IG_like 80..175 CDD:214653 41/133 (31%)
Ig strand A' 83..85 CDD:409355 0/1 (0%)
Ig strand B 89..97 CDD:409355 4/7 (57%)
CDR1 97..104 CDD:409355 0/6 (0%)
FR2 105..114 CDD:409355 5/8 (63%)
Ig strand C 105..110 CDD:409355 2/4 (50%)
CDR2 115..129 CDD:409355 4/13 (31%)
Ig strand D 129..135 CDD:409355 2/44 (5%)
FR3 130..159 CDD:409355 13/28 (46%)
Ig strand E 139..145 CDD:409355 4/5 (80%)
Ig strand F 153..160 CDD:409355 5/6 (83%)
IG_like 184..271 CDD:214653 27/98 (28%)
Ig strand B 194..198 CDD:409353 1/3 (33%)
Ig strand C 209..213 CDD:409353 3/3 (100%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.