DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and tutl

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:474 Identity:98/474 - (20%)
Similarity:142/474 - (29%) Gaps:170/474 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PADLPHMLRNASSGAAPPADIG-------PSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAK 191
            |.::|....:...|     ||.       |:...:.:.|.:.:....     |..:.||.:..|:
  Fly    34 PLEIPEQRASKCRG-----DIDRTTTTTIPASKTLTASPAKTAAFTV-----KTTRRRRSRRRAE 88

  Fly   192 EREL---LPRRQLSLPPLNATVQAGQHAY-----LPCKLNQHSGKPLSWVRLR---DEHIIAVDH 245
            ...:   :.|.|.|.|  ..|:|..|...     |..|..|....|...|.:.   .|.:|...|
  Fly    89 GSSICVPIRRGQGSTP--TPTIQVLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCH 151

  Fly   246 TTFINDARFASLLQ-----STTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSW- 304
            ..|.||.....:||     |.|.:.|           |:.....|:...:..|. :|..|.:|. 
  Fly   152 VEFPNDHPVPYVLQWDKKVSETGSDL-----------PIYIWYESYPEHIEEGY-KGRVSRVSQD 204

  Fly   305 ------TLQIKYVNLEDAGWYECQ---LATEPKMSAKVQLFVI----TPRTELIGDRQRFVKAGS 356
                  :|.:..:...|.|||||:   |..:||.......|.:    .||..:..:...:|..|.
  Fly   205 SPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGD 269

  Fly   357 RVELHCIVRGTLEAPKYIFWYRGDQQV------------------TAENEASGAQSGWYTQIDRN 403
            .:.|:|...|| ..|: |.||:....|                  |..:|    ..|.||.|.||
  Fly   270 SIILNCQADGT-PTPE-ILWYKDANPVDPSPTVGIFNDGTELRISTIRHE----DIGEYTCIARN 328

  Fly   404 IFGSTEHNRNTI----------------------------------------------------- 415
            ..|...|....|                                                     
  Fly   329 GEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAALE 393

  Fly   416 --------GSLVIPLVRKIHSGNYTCEPEN------SAAASMQLHVLSGEYSASAIKSTAARPHR 466
                    |||:|..::...||.|.||..|      ||:|     .||.||.|...         
  Fly   394 TRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASA-----YLSVEYPAKVT--------- 444

  Fly   467 LGHGYTSLHQWLIFLLVAL 485
                :|...|:|.|.|..:
  Fly   445 ----FTPTVQYLPFRLAGV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 35/154 (23%)
Ig <298..338 CDD:299845 13/49 (27%)
IG_like 352..447 CDD:214653 35/179 (20%)
Ig 358..439 CDD:143165 30/165 (18%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 28/124 (23%)
IG_like 137..229 CDD:214653 24/103 (23%)
I-set 253..341 CDD:254352 23/93 (25%)
IGc2 268..331 CDD:197706 18/68 (26%)
I-set 346..437 CDD:254352 14/95 (15%)
Ig 349..437 CDD:299845 14/92 (15%)
Ig 459..530 CDD:299845 0/1 (0%)
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.