DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and negr1

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:323 Identity:73/323 - (22%)
Similarity:116/323 - (35%) Gaps:85/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 VDHTT----FINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGN-SSSL 302
            ||:||    .::.....:||:...|..:..|..|:.::  :...||......|......| ....
Zfish    38 VDYTTSSESVVSRQGDTALLRCYLLDGISKGAWLNRSS--IIYAGNDKWSGDPRVSIVSNVGDKH 100

  Fly   303 SWTLQIKYVNLEDAGWYECQLATEPKMSAK-VQLFVITPRTELIGDRQRFVKAGSRVELHCIVRG 366
            .::|||:.|::.|.|.|.|.:.:|..:..| :||.|..|...........|..||.|.|.|...|
Zfish   101 EYSLQIQKVDVTDEGVYTCSIQSERNLHPKLIQLIVKVPPKIYDISSDITVNEGSNVSLICAASG 165

  Fly   367 TLEAPKYIFW------------------------YRGDQQVTAENE------------------- 388
            ..| || |.|                        ..||.:..|||:                   
Zfish   166 KPE-PK-ISWRHISPSARKYESGEYLNITGISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAI 228

  Fly   389 ----ASGAQSG------------------WYTQIDRNIFGS--TEHNRNTIGSLVIPLVRKIHSG 429
                :.|.:.|                  ||....|...|.  ..:|.::...|.:..:.:...|
Zfish   229 HEMKSHGVRPGQVALLRCEAAAVPSPVFEWYKGEKRINMGQGIVINNLSSRSVLTVKNMTQDRYG 293

  Fly   430 NYTCEPEN---SAAASMQLHVLSGEYSASAIKSTAARPHRLGHGYTSLHQWLI---FLLVALN 486
            ||||...|   :|.||:.|:.:....:.||:.|.|:.|..  :|.|...:.|:   :|::||:
Zfish   294 NYTCVAVNRLGTANASVPLNPIIEPTTTSAVSSPASNPAM--YGSTGGAEVLLACWYLILALS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 25/99 (25%)
Ig <298..338 CDD:299845 13/41 (32%)
IG_like 352..447 CDD:214653 35/164 (21%)
Ig 358..439 CDD:143165 28/150 (19%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 18/80 (23%)
IG_like 44..136 CDD:214653 21/93 (23%)
I-set 140..222 CDD:254352 17/83 (20%)
IGc2 153..208 CDD:197706 14/56 (25%)
IG_like 236..312 CDD:214653 16/75 (21%)
IGc2 238..304 CDD:197706 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.