DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Dscam3

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:578 Identity:113/578 - (19%)
Similarity:177/578 - (30%) Gaps:220/578 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LAATATPMENASLIASPATGTSTMGSAGSPVLMLGDDQQQQEYDTTVVDSWSDRPDTATLTKGFS 121
            ||..|||     |:|:......|.....:|.|:.|:|...|                .|.|...|
  Fly    22 LAVLATP-----LLATSGLRVPTFLLEPAPRLLFGNDTGAQ----------------VTCTAHGS 65

  Fly   122 IPSYLPPFPEFIPADLPHMLRNASSGAAPPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRRE 186
             |   ||...::       ||:.|.....|.....||:.....|...::.:..|..:...:.|..
  Fly    66 -P---PPLVTWV-------LRDGSLATQVPGLRKISGNGTLHFPPFLAQYYRTDVHEATYRCRAS 119

  Fly   187 KE----LAKEREL--LPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEH------ 239
            .|    |::..::  :.|||..:...|..|..|..|.:.|.:.::. :|  :||:...|      
  Fly   120 NEAGTVLSRNVQVHAVVRRQFHVHVENTEVYLGNSALIKCAIPEYV-RP--YVRVASWHRGEEIL 181

  Fly   240 ------------IIAVDHTTFINDAR-------FASLLQST-------------TLTTLVSGGAL 272
                        ::|.....::...|       |:.|:.:|             .:..|....|.
  Fly   182 LPDLSDVAGRYVVLAASGDLYVRSVRSEDGLMKFSCLVTNTLNGERQRSDAVMLQVKELSKNLAP 246

  Fly   273 STTATPVAAL---------------GNSF-------------AHAVPGGQERGNSSSLSWTLQIK 309
            .||..||..:               ||.|             .:.:|..|....|.:|   |.||
  Fly   247 RTTQKPVMEIHVERGNDVHLPCNIQGNPFPIFTWYRVSDSAALYPIPSSQRVILSRTL---LLIK 308

  Fly   310 YVNLEDAGWYECQLAT-------EPKMSAKVQLFV-ITPRTELIGDRQRFVKAGSRVELHCIVRG 366
            ..:..|||.:.||.:.       |.::|....:.| |.|:.::       |.:|.....:|...|
  Fly   309 NADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQVQI-------VNSGGTANFNCTTTG 366

  Fly   367 TLEAPKYIFWY------------------------------------RGDQQVTAENEASGAQSG 395
            :  |...|.|.                                    ||..|...||:.:.||:.
  Fly   367 S--AIDAIDWLHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQRASAQAM 429

  Fly   396 ------------WYTQIDRNI------------FGS-----------------TEHNRNTIGSLV 419
                        .||.|::|:            .||                 :.|:|..||..|
  Fly   430 AELKLGDTVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAIGQFV 494

  Fly   420 -----------IPLVRKIHSGNYTCEPENSAAA---SMQLHVLSGEY--SASAIKSTA 461
                       |..||....|.|.|...||..:   |.:|:|....|  :...||:.|
  Fly   495 DMSGDVISHLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGPPYVRAIGPIKAVA 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 37/204 (18%)
Ig <298..338 CDD:299845 13/47 (28%)
IG_like 352..447 CDD:214653 35/185 (19%)
Ig 358..439 CDD:143165 30/168 (18%)
Dscam3NP_996226.2 IG 56..133 CDD:214652 18/103 (17%)
Ig 56..125 CDD:143165 17/95 (18%)
I-set 246..337 CDD:254352 20/93 (22%)
Ig 264..334 CDD:143165 16/72 (22%)
I-set 345..433 CDD:254352 16/96 (17%)
Ig 358..431 CDD:143165 12/74 (16%)
Ig 456..533 CDD:143165 16/76 (21%)
IGc2 553..619 CDD:197706 113/578 (20%)
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.