DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr5

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:407 Identity:101/407 - (24%)
Similarity:162/407 - (39%) Gaps:127/407 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ATGTSTMGSAGSPVL--MLGDDQQQQEYDTTVVDSWSDRPDTATLTKGFSIPSYLPPFPEFIPAD 136
            ||.|||..:..||::  ::.:.:..|.....:|                          |:..|.
  Fly     9 ATFTSTTATESSPLIGKVISNSRAPQIAHEMLV--------------------------EYFMAL 47

  Fly   137 LPHMLRNASSGAAPPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQL 201
            |..|      |...|.|             :|||    .|.|....|...:||:   .|:|....
  Fly    48 LVIM------GLTAPVD-------------KQSR----RSSQYFGHLAAAEELS---NLIPDNYD 86

  Fly   202 SLPPL--NAT-----VQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQ 259
            ::.|:  |.|     ...|..|.|.|::.....:.:||:|.||.||:.:...|:.||.||.:   
  Fly    87 AIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLA--- 148

  Fly   260 STTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLA 324
                                                |...:|..|.|:|..|...|||.||||::
  Fly   149 ------------------------------------RHIDNSDEWVLKIVSVQQRDAGVYECQVS 177

  Fly   325 TEPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAP---KYIFWYRGDQQVTAE 386
            ||||:|...:|.|:|.:.:::.:|:.|:::||.:.|.||..   :||   .::.|:: |.::.::
  Fly   178 TEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAP---QAPGPYTHMLWHK-DTELVSD 238

  Fly   387 NEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGE 451
            :...|            |...:|....| .:|||..|:...||||||..:||.:.|:.:|::..|
  Fly   239 SARGG------------IRVESEQQMKT-SNLVISRVQHTDSGNYTCSADNSNSDSVFVHIIKSE 290

  Fly   452 YSASAIKSTAARPHRLG 468
                   ..||..|.||
  Fly   291 -------QHAAMQHELG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 38/138 (28%)
Ig <298..338 CDD:299845 18/39 (46%)
IG_like 352..447 CDD:214653 26/97 (27%)
Ig 358..439 CDD:143165 22/83 (27%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 36/134 (27%)
IG_like 98..179 CDD:214653 29/119 (24%)
IG_like 206..278 CDD:214653 24/88 (27%)
Ig 211..278 CDD:143165 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.