DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Ama

DIOPT Version :10

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:268 Identity:53/268 - (19%)
Similarity:87/268 - (32%) Gaps:108/268 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LSLPPL-----NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEH-----IIAVDHTTFINDARFA 255
            ||.|.:     :.....|......|.:.:.....:||.:...|.     ::::.:...:.|.|: 
  Fly    30 LSAPVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRY- 93

  Fly   256 SLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYE 320
                :.|:|                              |...:.|..:|.:|:.:.:.|.|.||
  Fly    94 ----NVTVT------------------------------EGPKTGSAIYTFRIQNIEVSDMGPYE 124

  Fly   321 CQL---ATEPKMSAKVQLFVITPRTELIGD---RQRFVKAGSRVELHCIVRGTLEAPK-YIFWYR 378
            ||:   ||| |::.|:.|.:.||  .:|.:   :...|..|..:||.|...|   .|| .|.|.|
  Fly   125 CQVLVSATE-KVTKKLSLQIKTP--PVIAENTPKSTLVTEGQNLELTCHANG---FPKPTISWAR 183

  Fly   379 GDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPL-----------VRKIH---SG 429
                                          |||      .|:|.           :|.:|   .|
  Fly   184 ------------------------------EHN------AVMPAGGHLLAEPTLRIRSVHRMDRG 212

  Fly   430 NYTCEPEN 437
            .|.|..:|
  Fly   213 GYYCIAQN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 352..447 CDD:214653 22/101 (22%)
Ig strand B 358..362 CDD:409353 2/3 (67%)
Ig strand C 373..377 CDD:409353 1/3 (33%)
Ig strand E 416..420 CDD:409353 0/3 (0%)
Ig strand F 430..435 CDD:409353 2/4 (50%)
AmaNP_731114.2 I-set 33..143 CDD:400151 26/145 (18%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 2/10 (20%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 23/114 (20%)
I-set 254..330 CDD:400151
Ig strand B 255..259 CDD:409353
Ig strand C 268..272 CDD:409353
Ig strand E 298..302 CDD:409353
Ig strand F 312..317 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.