DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and LSAMP

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:380 Identity:80/380 - (21%)
Similarity:119/380 - (31%) Gaps:143/380 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LRREKELAKERELLPRRQLSLPPL--------------NATVQAGQHAYLPCKLNQHSGKPLSWV 233
            :||.:...|:..|:..|.|.|.|.              |.||:.|..|.|.|.:...:.| ::| 
Human     2 VRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSK-VAW- 64

  Fly   234 RLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGN 298
             |....||...|..:..|.|.                                        |...
Human    65 -LNRSGIIFAGHDKWSLDPRV----------------------------------------ELEK 88

  Fly   299 SSSLSWTLQIKYVNLEDAGWYECQLAT--EPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELH 361
            ..||.::|:|:.|::.|.|.|.|.:.|  |||.|....:..:.|:...|.. ...|..||.|.|.
Human    89 RHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISS-DVTVNEGSNVTLV 152

  Fly   362 CIVRGTLEAPKYIFW---------YRGDQQ------VTAE------------------------- 386
            |:..|..|  ..|.|         :.|:::      :|.|                         
Human   153 CMANGRPE--PVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTV 215

  Fly   387 -----------NEA-SGAQSG--------------WYTQIDRNIFGSTEHNRNTIG--SLVIPLV 423
                       ||| :|.|:.              ||....|....:....::|.|  ||.:..|
Human   216 NYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNV 280

  Fly   424 RKIHSGNYTCEPENSAAASMQLHVLSGEYSASAI---KSTAARPHRLGHGYTSLH 475
            .:.|.|||||...|..          |..:||.:   :.....||.:....|::|
Human   281 TEEHYGNYTCVAANKL----------GVTNASLVLFKRVLPTIPHPIQEIGTTVH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 31/147 (21%)
Ig <298..338 CDD:299845 14/41 (34%)
IG_like 352..447 CDD:214653 33/162 (20%)
Ig 358..439 CDD:143165 30/148 (20%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 30/132 (23%)
Ig 132..215 CDD:386229 15/85 (18%)
Ig_3 219..294 CDD:372822 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.