DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr10

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:366 Identity:89/366 - (24%)
Similarity:134/366 - (36%) Gaps:128/366 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NASSGAAPPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLN 207
            |.::..|.|....||..|...|.||                             |...|:: |.|
  Fly    28 NHNNAEAKPTHAPPSHYPHGHKWNE-----------------------------PYFDLTM-PRN 62

  Fly   208 ATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGAL 272
            .|...|:.|||.|::.....|.::|:|.||.||:.|...|:..|.||.:                
  Fly    63 ITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQT---------------- 111

  Fly   273 STTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLFV 337
                        |:...:.           .||||||:....|||.||||::|:|..|..|.|.:
  Fly   112 ------------SYHRDID-----------EWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNI 153

  Fly   338 I----------------------------------------------TPRTELIGDRQRFVKAGS 356
            :                                              .|...::|....:|..||
  Fly   154 VDLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGS 218

  Fly   357 RVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIP 421
            .:.|.||::.:.|.|.:||||..|:.::  .|.||.:..:          .|..:..|...|:|.
  Fly   219 TINLTCIIKFSPEPPTHIFWYHQDKVLS--EETSGGRLKF----------KTIKSEETKSILLIY 271

  Fly   422 LVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAA 462
            ....:|||.|:|.|.|:..||:::|||.|| ...|:::.||
  Fly   272 DADLLHSGKYSCYPSNTEIASIRVHVLQGE-RPEAMQTNAA 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 39/131 (30%)
Ig <298..338 CDD:299845 18/39 (46%)
IG_like 352..447 CDD:214653 29/94 (31%)
Ig 358..439 CDD:143165 24/80 (30%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 33/118 (28%)
IG_like 210..297 CDD:214653 29/98 (30%)
IGc2 217..287 CDD:197706 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444667
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.