DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dscamb

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_009289749.1 Gene:dscamb / 386937 ZFINID:ZDB-GENE-031118-67 Length:2020 Species:Danio rerio


Alignment Length:479 Identity:99/479 - (20%)
Similarity:151/479 - (31%) Gaps:172/479 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GTASILLAFLAAVSFRGMRAPLAATATPMENASLIASPATGTSTMGSAGSPVLMLGDDQQQQEYD 100
            ||..||.||...|            .:|.|..||:.      ...|:....|....||      |
Zfish   405 GTPKILSAFSEKV------------VSPNEPISLVC------HVKGTPLPTVTWTLDD------D 445

  Fly   101 TTVVDSWSDRPDTATLTKGFSIPSYLPPFPEFIPADLPHMLRNASSGAAPPADIGPSGSPMPSKP 165
            ..:.|| :.|.|....|:| .:.|||         ::.|  ...|.|.........|...:    
Zfish   446 PVIKDS-NHRMDRIITTEG-HVLSYL---------NVSH--TQVSDGGVYRCTCNNSAGSV---- 493

  Fly   166 NEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPL-NATVQAGQHAYLPCKLNQHSGKP 229
            :.|:|::.                        |...|:.|: |.|..||:..|:.|::..:....
Zfish   494 SYQARINV------------------------RGPASIRPMKNVTAIAGRDTYIHCRIIGYPYYS 534

  Fly   230 LSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQ 294
            :.|  .:|.:::..:|                                                 
Zfish   535 IKW--YKDSNLLPFNH------------------------------------------------- 548

  Fly   295 ERGNSSSLSWTLQIKYVNLEDAGWYECQLATEP--KMSAKVQLFVITPRTELIGDRQRFVKAGSR 357
             |..:...:.||::..|...|.|.|.|.:..:|  ::...|.:.|..|......|.|. ...|.|
Zfish   549 -RQRAFENNGTLKLSNVQNSDEGEYTCYVLVDPEKQIHRSVHVTVKVPPLIQHSDSQS-ASIGQR 611

  Fly   358 VELHCIV-RGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIP 421
            |.:.|:| .|.|  |..|.|::..:.:.|.                  .|.|..|.:...||.|.
Zfish   612 VFIPCVVISGDL--PMSITWHKDGRPINAS------------------LGVTIDNIDFTSSLRIS 656

  Fly   422 LVRKIHSGNYTCEPENSAAA---SMQLHV------------LSGEYSASAIKSTAAR-------- 463
            .:.:||:|:|||...|.|||   |:||.|            ..|.|..|...:.:|:        
Zfish   657 NLSEIHNGSYTCIARNEAAAVEHSIQLIVKVPPHFEVQPKDQDGIYGKSVTLNCSAKGNPIPTIV 721

  Fly   464 -PHRLGHGYTSLHQWLIFLLVALN 486
             .|..|.|...      |..:|||
Zfish   722 WNHSKGAGVPQ------FQPIALN 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 20/134 (15%)
Ig <298..338 CDD:299845 9/41 (22%)
IG_like 352..447 CDD:214653 30/98 (31%)
Ig 358..439 CDD:143165 22/81 (27%)
dscambXP_009289749.1 I-set 132..198 CDD:254352
I-set 225..310 CDD:254352
IGc2 239..300 CDD:197706
IG_like 320..400 CDD:214653
IGc2 328..391 CDD:197706
IG_like 417..501 CDD:214653 25/124 (20%)
Ig 424..498 CDD:143165 21/102 (21%)
IG_like 511..592 CDD:214653 19/132 (14%)
IGc2 518..576 CDD:197706 14/109 (13%)
I-set 595..685 CDD:254352 33/110 (30%)
Ig 612..682 CDD:143165 26/89 (29%)
I-set 689..785 CDD:254352 11/57 (19%)
Ig7_DSCAM 706..785 CDD:143211 8/40 (20%)
IG_like 795..883 CDD:214653
Ig 803..890 CDD:299845
FN3 887..980 CDD:238020
FN3 987..1084 CDD:238020
FN3 1092..1185 CDD:238020
FN3 1190..1279 CDD:238020
IGc2 1302..1367 CDD:197706
FN3 1398..1471 CDD:238020
FN3 1485..1557 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.