DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Gm5150

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001075156.1 Gene:Gm5150 / 381484 MGIID:3779469 Length:299 Species:Mus musculus


Alignment Length:267 Identity:58/267 - (21%)
Similarity:93/267 - (34%) Gaps:68/267 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PPLNATVQAGQHAYLPCKLNQ--HSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTL 266
            |..:.:|:||..|.|.|.:..  ..| |:.|.|       .|.|.        .:|:.|.|    
Mouse    36 PEKSVSVRAGGSATLNCTVTSLLPVG-PIRWYR-------GVGHR--------RNLIYSYT---- 80

  Fly   267 VSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYEC----QLATEP 327
                            |..|.. :....:..|..:|.:::.|.||...|||.|.|    :..:||
Mouse    81 ----------------GEHFPR-ITNVSDTTNRRNLDFSICISYVTFADAGTYYCVKFQKGPSEP 128

  Fly   328 KM--------------SAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYR 378
            .:              :|..:|.||.|      ::...|:||....|:|.|...:.... :.|||
Mouse   129 DIEIQSGGGTELFVLGAAGKELKVIQP------EKSVSVRAGGLATLNCTVTSLIPVGP-MRWYR 186

  Fly   379 GDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASM 443
            |   |........:.:|.:.....|:..:|: .||...|:.|..|....:..|.|.......:..
Mouse   187 G---VGHRRNLIYSYTGEHFPRITNVSDATK-RRNLDFSIRISDVTFADADTYYCVKFQKGPSES 247

  Fly   444 QLHVLSG 450
            .:.:.||
Mouse   248 DIEIQSG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 31/151 (21%)
Ig <298..338 CDD:299845 14/57 (25%)
IG_like 352..447 CDD:214653 21/94 (22%)
Ig 358..439 CDD:143165 18/80 (23%)
Gm5150NP_001075156.1 Ig 32..143 CDD:386229 30/143 (21%)
Ig 151..262 CDD:386229 26/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.