DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and CG13506

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:451 Identity:88/451 - (19%)
Similarity:140/451 - (31%) Gaps:157/451 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LIASPATGTSTMGSAGSPV--LMLGDDQQQQEY---------DTTVVDSWSDRPDTATLTKGFSI 122
            |:.|...|...:..||||:  .:.|.|.|..||         ||.::|          :||..: 
  Fly    11 LLISLLIGQLYVSCAGSPIDADVKGTDYQDDEYEYGDDTDDDDTQIID----------VTKNHA- 64

  Fly   123 PSYLPPF-------PEFIPAD--------LPHMLRNA----------SSGAAPPA---------- 152
            ....||:       .|..|.|        ....|.||          ::|..|.:          
  Fly    65 EQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNNS 129

  Fly   153 ----DIGPSGSP------MPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLN 207
                ::.|..|.      :|.:..:.:.|...         .|...|..:|::..|.|       
  Fly   130 ILLRNVSPEDSDDYYCEILPQRVRQHTALRVG---------ARLSILCDDRDITDRSQ------- 178

  Fly   208 ATVQAGQHAYLPCK------------LNQHSGKPLS--------------------WVRLRDEHI 240
             |.:.|.|..|.|:            .|..:|:|.|                    :..|.|:..
  Fly   179 -TFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGS 242

  Fly   241 IAVDHTTFINDARFASLLQSTTLTTLVSGGALST-----TATPVAALGNSFAHAVPGGQERGNSS 300
            ....|.|...|.:::.::.:.........||.:.     .|.|:   |.|:  .:..|:....|.
  Fly   243 RHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPI---GRSY--FIKDGKTLQLSD 302

  Fly   301 SLS-----------WTLQIKYVNLEDAGWYECQLATEPKMSAKVQLFV-ITPRTELIGDRQRFVK 353
            ..|           .||.::.|...|.|.|.||:..... |.:|::.| ..|.|....|   ...
  Fly   303 KYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIG-SNEVKVHVSYNPETPQFED---MTV 363

  Fly   354 AGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNT 414
            .|::|.||.:||              ..|:.:|.......:|.||.....:..:..|| ||
  Fly   364 EGNKVTLHWLVR--------------SHQLLSEAMLDYQLTGSYTWSTVQVLETHRHN-NT 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 33/179 (18%)
Ig <298..338 CDD:299845 13/51 (25%)
IG_like 352..447 CDD:214653 15/63 (24%)
Ig 358..439 CDD:143165 14/57 (25%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 10/66 (15%)
IGc2 83..146 CDD:197706 9/62 (15%)
IG_like 176..254 CDD:214653 15/85 (18%)
Ig 176..239 CDD:299845 12/70 (17%)
I-set 258..349 CDD:254352 19/96 (20%)
Ig 275..348 CDD:143165 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.