DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Lac

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:176 Identity:50/176 - (28%)
Similarity:74/176 - (42%) Gaps:30/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 RGNSSSLSWTLQIKYVNLEDAGWYECQ--LATEPKMSAKVQLFVITPRTELIGDRQRFVKA-GSR 357
            |.:.:|.::.||||.:...|||.|.||  ::|..|:||:|:|.|..|........|..|.: ||.
  Fly    88 RYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSV
RRPPVISDNSTQSVVASEGSE 152

  Fly   358 VELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPL 422
            |::.|...| ...|. |.|.|.:..:...:.|:             ..|:|         |.|..
  Fly   153 VQMECYASG-YPTPT-ITWRRENNAILPTDSAT-------------YVGNT---------LRIKS 193

  Fly   423 VRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAARPHRLG 468
            |:|...|.|.|..:|..:...:.::......|..|  |..|| |||
  Fly   194 VKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVI--TVPRP-RLG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 18/42 (43%)
Ig <298..338 CDD:299845 17/41 (41%)
IG_like 352..447 CDD:214653 21/95 (22%)
Ig 358..439 CDD:143165 18/80 (23%)
LacNP_523713.2 IG_like 36..131 CDD:214653 18/42 (43%)
FR1 37..50 CDD:409353
Ig strand A' 37..42 CDD:409353
Ig strand B 44..51 CDD:409353
CDR1 51..59 CDD:409353
Ig strand C 59..63 CDD:409353
FR2 60..63 CDD:409353
CDR2 67..81 CDD:409353
Ig strand C' 68..72 CDD:409353
Ig strand C' 79..81 CDD:409353
FR3 84..115 CDD:409353 11/26 (42%)
Ig strand D 84..90 CDD:409353 1/1 (100%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 2/7 (29%)
FR4 124..130 CDD:409353 3/5 (60%)
Ig strand G 124..130 CDD:409353 3/5 (60%)
Ig_3 134..208 CDD:404760 22/97 (23%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/4 (25%)
Ig strand E 187..191 CDD:409353 2/12 (17%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 7/13 (54%)
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.