| Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038944379.1 | Gene: | Cadm2 / 360687 | RGDID: | 1305678 | Length: | 444 | Species: | Rattus norvegicus |
| Alignment Length: | 275 | Identity: | 60/275 - (21%) |
|---|---|---|---|
| Similarity: | 95/275 - (34%) | Gaps: | 85/275 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 205 PL--NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLV 267
Fly 268 SGGALSTTATPVAALGNSFAHAVPGGQERGNSSSL---SW---TLQIKYVNLEDAGWYECQLATE 326
Fly 327 PKMSAKVQLFVI-TPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQV-----TA 385
Fly 386 ENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPEN---SAAASMQLHV 447
Fly 448 LSGEYSASA--IKST 460 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 32/139 (23%) |
| Ig | <298..338 | CDD:299845 | 15/45 (33%) | ||
| IG_like | 352..447 | CDD:214653 | 18/102 (18%) | ||
| Ig | 358..439 | CDD:143165 | 15/88 (17%) | ||
| Cadm2 | XP_038944379.1 | IgV_1_Necl-3 | 35..130 | CDD:409498 | 32/140 (23%) |
| Ig strand B | 49..53 | CDD:409498 | 2/3 (67%) | ||
| Ig strand C | 62..66 | CDD:409498 | 1/3 (33%) | ||
| Ig strand E | 96..100 | CDD:409498 | 0/3 (0%) | ||
| Ig strand F | 110..115 | CDD:409498 | 2/4 (50%) | ||
| Ig strand G | 122..125 | CDD:409498 | 0/2 (0%) | ||
| IgI_2_Necl-3 | 129..232 | CDD:409467 | 23/121 (19%) | ||
| Ig strand B | 151..155 | CDD:409467 | 1/3 (33%) | ||
| Ig strand C | 165..169 | CDD:409467 | 1/4 (25%) | ||
| Ig strand E | 195..199 | CDD:409467 | 0/3 (0%) | ||
| Ig strand F | 209..214 | CDD:409467 | 3/16 (19%) | ||
| Ig strand G | 225..228 | CDD:409467 | 0/2 (0%) | ||
| IGc2 | 249..312 | CDD:197706 | |||
| Ig strand B | 251..260 | CDD:409353 | |||
| Ig strand C | 266..272 | CDD:409353 | |||
| Ig strand C' | 275..278 | CDD:409353 | |||
| Ig strand D | 281..286 | CDD:409353 | |||
| Ig strand E | 287..294 | CDD:409353 | |||
| Ig strand F | 301..309 | CDD:409353 | |||
| Ig strand G | 312..322 | CDD:409353 | |||
| 4.1m | 397..415 | CDD:128590 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I5126 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||