DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Dscam1

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:313 Identity:63/313 - (20%)
Similarity:109/313 - (34%) Gaps:111/313 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LPPLNATVQAGQHAYLPCKLNQHSGKPL---SWVR-----------LRDEHIIAVD---HTTFI- 249
            :.|...||..|:.|...|   |::|.|:   ||::           ||.|.:...|   :..|: 
  Fly   351 IDPPTQTVDFGRPAVFTC---QYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVR 412

  Fly   250 NDARFASLLQSTTLTTLVSGGAL----------STTATPVAALGNSFAHAVPGGQERGNSSSLSW 304
            ||...|.......|     ||..          ..|..|..::   |...|.||..   :..:||
  Fly   413 NDQESAEASAELKL-----GGRFDPPVIRQAFQEETMEPGPSV---FLKCVAGGNP---TPEISW 466

  Fly   305 TLQ----------------------IKYVNL-----EDAGWYECQLATE---PKMSAKVQLFVIT 339
            .|.                      :.|:|:     .|.|.|:|...::   .:.|||:.::.:.
  Fly   467 ELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLP 531

  Fly   340 PRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKY----IFWYRGDQQVTAENEASGAQSGWYTQI 400
            ...::   .::.:.||..:.:.|.|.|      |    |.|.|.::.:....:            
  Fly   532 YIRQM---EKKAIVAGETLIVTCPVAG------YPIDSIVWERDNRALPINRK------------ 575

  Fly   401 DRNIFGSTEHNRNTIGSLVIPLV-RKIHSGNYTCEPEN----SAAASMQLHVL 448
             :.:|.:        |:|:|..| |......|||..:|    ||..|:::.|:
  Fly   576 -QKVFPN--------GTLIIENVERNSDQATYTCVAKNQEGYSARGSLEVQVM 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 40/189 (21%)
Ig <298..338 CDD:299845 12/69 (17%)
IG_like 352..447 CDD:214653 22/103 (21%)
Ig 358..439 CDD:143165 17/89 (19%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653 19/74 (26%)
IGc2 361..413 CDD:197706 13/54 (24%)
I-set 433..527 CDD:254352 18/99 (18%)
IGc2 446..517 CDD:197706 14/76 (18%)
I-set 533..618 CDD:254352 22/114 (19%)
IGc2 544..607 CDD:197706 18/89 (20%)
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.