DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr19

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:306 Identity:72/306 - (23%)
Similarity:122/306 - (39%) Gaps:97/306 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 QAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTT 275
            |.|..|.|||.:..:|...:||:|.:|..::.|..:|..:|.||  |::.|              
  Fly    53 QKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRF--LVEHT-------------- 101

  Fly   276 ATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLFVITP 340
                              :..|:     |:|:||.|..||.|:|||||:..|..|..::|.::..
  Fly   102 ------------------RHMGH-----WSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEA 143

  Fly   341 RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEA---------SGAQSGW 396
            ..|:....:..:...|.:.|.|.::...|.|.::|||...:.:..:::.         |..|||.
  Fly   144 VAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQ 208

  Fly   397 YTQ------------------IDRNIFGS------------------TEHNRN------TIGSLV 419
            :.:                  :..::.||                  |:.:::      ::..|.
  Fly   209 FYRSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLT 273

  Fly   420 IPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIKSTAARPH 465
            :..|...|:|||||.|.|:..||:.:|||.||       .|||..|
  Fly   274 VKQVNFRHAGNYTCAPSNARPASITVHVLRGE-------KTAAMQH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 35/125 (28%)
Ig <298..338 CDD:299845 16/39 (41%)
IG_like 352..447 CDD:214653 27/145 (19%)
Ig 358..439 CDD:143165 24/131 (18%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 31/112 (28%)
IGc2 55..125 CDD:197706 28/108 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.