DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and DIP-theta

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:273 Identity:63/273 - (23%)
Similarity:100/273 - (36%) Gaps:87/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 EKELAKERELLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFIN 250
            ||:|.|..|||.         |.||...:.|.|.|.::......::|:|:..:.|:.:.:.....
  Fly   126 EKDLPKFGELLQ---------NVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITK 181

  Fly   251 DARFASLLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLED 315
            :.|.                              |..||    ::|      :|.|:|:.|...|
  Fly   182 NHRM------------------------------SITHA----EKR------AWILRIRDVKESD 206

  Fly   316 AGWYECQLATEPKMSAKVQLFVITP--------RTELIGDRQRFVKAGSRVELHCIVRGTLEAPK 372
            .|||.||:.|:|..|....|.|:.|        .|:::      ::.||.|.|.|...|: ..|.
  Fly   207 KGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMV------IREGSNVTLKCAATGS-PTPT 264

  Fly   373 YIFWYR-GDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGS-LVIPLVRKIHSGNYTCEP 435
             |.|.| |.:.:...|   ||::..|.                 || |.|..|.:::.|.|.|..
  Fly   265 -ITWRREGGELIPLPN---GAEAVAYN-----------------GSFLTIAKVNRLNMGAYLCIA 308

  Fly   436 ENSAAASMQLHVL 448
            .|....::...|:
  Fly   309 SNGIPPTVSKRVM 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 28/131 (21%)
Ig <298..338 CDD:299845 14/39 (36%)
IG_like 352..447 CDD:214653 24/96 (25%)
Ig 358..439 CDD:143165 22/82 (27%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/141 (21%)
IG_like 137..230 CDD:214653 29/141 (21%)
IG_like 240..324 CDD:214653 26/110 (24%)
IGc2 247..310 CDD:197706 23/84 (27%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.