DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and bdl

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:252 Identity:55/252 - (21%)
Similarity:80/252 - (31%) Gaps:73/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTT 265
            :.:||:|.|::.||.|:..|.:........||.                   :...|||.     
  Fly   153 IRIPPVNQTIREGQTAFFHCVMKHPENSQASWY-------------------KDGVLLQE----- 193

  Fly   266 LVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATE--PK 328
                         |..|...| :..|.|           :|.|....:.|.|.|||::...  ..
  Fly   194 -------------VQDLVRRF-YMGPDG-----------SLSIDPTMMSDLGEYECKVRNSDGEL 233

  Fly   329 MSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAP-KYIFWYRGDQQVTAENEASGA 392
            .:||..|.:......:....:.|:..|....|.|..|.  ..| |.:.|           |..|.
  Fly   234 QTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRA--NPPLKNLRW-----------EKDGL 285

  Fly   393 QSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLS 449
            ....|     |:.| ..:..|  |||....|.:.|:|:|||.|.|.........|:|
  Fly   286 LFDSY-----NVPG-VFYKMN--GSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVIS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 27/133 (20%)
Ig <298..338 CDD:299845 10/41 (24%)
IG_like 352..447 CDD:214653 24/95 (25%)
Ig 358..439 CDD:143165 23/81 (28%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 28/137 (20%)
Ig 157..242 CDD:299845 27/133 (20%)
Ig_2 252..337 CDD:290606 27/104 (26%)
IG_like 260..327 CDD:214653 24/87 (28%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.