DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and itgb4

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:217 Identity:40/217 - (18%)
Similarity:82/217 - (37%) Gaps:52/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SWSDRPDTATLTKGFSIPSYLPPFPEFIPADLPHMLRNASSGAAPPADIGPSGSPMPSKPNEQSR 170
            ||::..:...:..|:.: .|:|...:..|.                   ||....|...|.::..
Zfish  1350 SWAEPAEANGIITGYEV-IYMPINEDKKPT-------------------GPPKKVMIDNPKKRML 1394

  Fly   171 L--HAYDSEQKAQQLRREKELA----KEREL----LPRRQLSLP-----PLNATVQAGQH--AYL 218
            |  :...|:....::|...::.    :|..:    .|.|.:|:|     |: ...:||:.  :||
Zfish  1395 LIENLQPSQTYCYKVRASNKVGWGPYREATINLASQPTRPMSIPIIPDIPI-VDAEAGEEYDSYL 1458

  Fly   219 PCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFAS-LLQSTTLTTLVSGGALSTTATPVAAL 282
            ... |:....|.|.:|         ...|.::|.:|.: ..:...|.....||:||..   :::.
Zfish  1459 MYS-NEVLRSPTSSLR---------PSVTDLSDDQFVNGKWEQNFLFPGGGGGSLSRN---ISSS 1510

  Fly   283 GNSFAHAVPGGQERGNSSSLSW 304
            ..:::|:.|......|||:.::
Zfish  1511 STTYSHSTPRTNVTNNSSTTTY 1532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 22/103 (21%)
Ig <298..338 CDD:299845 3/7 (43%)
IG_like 352..447 CDD:214653
Ig 358..439 CDD:143165
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344
FN3 1242..1326 CDD:238020
FN3 1331..1420 CDD:238020 13/89 (15%)
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.