DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:92/269 - (34%) Gaps:87/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LPPLNATVQAGQHAYLPCKLNQHSGKPLS-----------WVRLRDEHIIAVDHTTFINDARFAS 256
            :|..|.|:..|:.|...|.:|...|..:|           |::...:.|:|:......|:.|.: 
  Fly   102 IPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRLS- 165

  Fly   257 LLQSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYEC 321
             :|.....|                                      |||.|:.|.:||||.|.|
  Fly   166 -VQHNDYNT--------------------------------------WTLNIRGVKMEDAGKYMC 191

  Fly   322 QLATEPKMSAKVQLFVITP----RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGD-Q 381
            |:.|:|.......|.|:.|    ..|..||  ..|..|...:|.|..||. ..|| |.|.|.| :
  Fly   192 QVNTDPMKMQTATLEVVIPPDIINEETSGD--MMVPEGGSAKLVCRARGH-PKPK-ITWRREDGR 252

  Fly   382 QVTAEN---EASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTC------EPEN 437
            ::.|.|   :.:.|||         :.|.         .|.:..:.:...|.|.|      .|..
  Fly   253 EIIARNGSHQKTKAQS---------VEGE---------MLTLSKITRSEMGAYMCIASNGVPPTV 299

  Fly   438 SAAASMQLH 446
            |....:|:|
  Fly   300 SKRMKLQVH 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 30/142 (21%)
Ig <298..338 CDD:299845 15/39 (38%)
IG_like 352..447 CDD:214653 26/105 (25%)
Ig 358..439 CDD:143165 21/90 (23%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 32/146 (22%)
ig 102..195 CDD:278476 28/132 (21%)
IG_like 219..307 CDD:214653 26/109 (24%)
Ig 221..307 CDD:299845 25/107 (23%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.