| Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510497.1 | Gene: | Opcml / 330908 | MGIID: | 97397 | Length: | 354 | Species: | Mus musculus |
| Alignment Length: | 259 | Identity: | 57/259 - (22%) |
|---|---|---|---|
| Similarity: | 96/259 - (37%) | Gaps: | 65/259 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271
Fly 272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATE--PKMSAKVQ 334
Fly 335 LFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFW----YRGDQQVTAENEASGAQSG 395
Fly 396 WYTQI-DRNIFGSTEHNRNTIGSLVIPLVRK----IHSGNYTCEPENSAAASMQLHVLSGEYSA 454 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 26/131 (20%) |
| Ig | <298..338 | CDD:299845 | 12/41 (29%) | ||
| IG_like | 352..447 | CDD:214653 | 24/103 (23%) | ||
| Ig | 358..439 | CDD:143165 | 20/89 (22%) | ||
| Opcml | XP_006510497.1 | Ig | 44..132 | CDD:416386 | 26/131 (20%) |
| Ig strand A' | 44..49 | CDD:409353 | 3/4 (75%) | ||
| Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 64..70 | CDD:409353 | 1/8 (13%) | ||
| Ig strand C | 64..70 | CDD:409353 | 1/8 (13%) | ||
| CDR2 | 71..83 | CDD:409353 | 1/11 (9%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 84..118 | CDD:409353 | 10/73 (14%) | ||
| Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 123..132 | CDD:409353 | 5/9 (56%) | ||
| FR4 | 125..132 | CDD:409353 | 3/7 (43%) | ||
| Ig_3 | 135..206 | CDD:404760 | 18/80 (23%) | ||
| Ig strand A | 135..138 | CDD:409353 | 1/2 (50%) | ||
| Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 151..160 | CDD:409353 | 4/8 (50%) | ||
| Ig strand C | 165..170 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
| Ig strand F | 198..206 | CDD:409353 | 1/7 (14%) | ||
| Ig_3 | 223..300 | CDD:404760 | 8/26 (31%) | ||
| putative Ig strand A | 224..230 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 253..257 | CDD:409353 | |||
| Ig strand E | 279..283 | CDD:409353 | |||
| Ig strand F | 293..298 | CDD:409353 | |||
| Ig strand G | 306..309 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||