DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr8

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:263 Identity:69/263 - (26%)
Similarity:115/263 - (43%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271
            |.|...|:...|.|::.....:.:||||.||.|::.|...|:.:|.||.::              
  Fly    51 NITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAM-------------- 101

  Fly   272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLF 336
                            |: |..::        |||:|:|...:|:|.||||::|.|.:...|.|.
  Fly   102 ----------------HS-PHAED--------WTLRIRYAQRKDSGIYECQISTTPPIGHSVYLN 141

  Fly   337 VITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQID 401
            ::.|.|::||..:..:..||.:.|.|||:...|.|..:.|....:.:..::...|          
  Fly   142 IVEPVTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGG---------- 196

  Fly   402 RNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAI-----KSTA 461
              |...||....|...|::.......||.|||.|.|:...|:::|::.||:.|:..     .|||
  Fly   197 --ISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTGNNGNSTA 259

  Fly   462 ARP 464
            ::|
  Fly   260 SQP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 34/129 (26%)
Ig <298..338 CDD:299845 15/39 (38%)
IG_like 352..447 CDD:214653 23/94 (24%)
Ig 358..439 CDD:143165 20/80 (25%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 30/118 (25%)
V-set 52..143 CDD:284989 33/129 (26%)
IG_like 153..238 CDD:214653 23/96 (24%)
ig 153..232 CDD:278476 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.