Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
Alignment Length: | 338 | Identity: | 68/338 - (20%) |
---|---|---|---|
Similarity: | 112/338 - (33%) | Gaps: | 119/338 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGA 271
Fly 272 LSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATE--PKMSAKVQ 334
Fly 335 LFVITPRTELIGDRQRFVKAGSRVELHCIVRG----------------TLEAPKYIFWY------ 377
Fly 378 RGDQQVTAENEAS--------------------------GAQSG---------------WYTQID 401
Fly 402 RNIFGSTE----HNRNTIGSLVIPLVRKIHSGNYTCEPEN---SAAASMQLHVLSGEYSASAIKS 459
Fly 460 TAARPHRLGHGYT 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 28/131 (21%) |
Ig | <298..338 | CDD:299845 | 12/41 (29%) | ||
IG_like | 352..447 | CDD:214653 | 32/164 (20%) | ||
Ig | 358..439 | CDD:143165 | 28/150 (19%) | ||
Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 5/13 (38%) |
Ig strand A' | 40..46 | CDD:409353 | 2/4 (50%) | ||
IG_like | 41..129 | CDD:214653 | 28/131 (21%) | ||
Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 56..60 | CDD:409353 | 1/3 (33%) | ||
FR2 | 61..68 | CDD:409353 | 3/9 (33%) | ||
Ig strand C | 61..67 | CDD:409353 | 2/8 (25%) | ||
CDR2 | 69..79 | CDD:409353 | 2/9 (22%) | ||
Ig strand C' | 71..74 | CDD:409353 | 2/2 (100%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 12/74 (16%) | ||
Ig strand D | 84..91 | CDD:409353 | 3/46 (7%) | ||
Ig strand E | 94..100 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 3/9 (33%) | ||
FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
Ig strand A' | 139..144 | CDD:409353 | 0/4 (0%) | ||
IGc2 | 146..204 | CDD:197706 | 12/57 (21%) | ||
Ig strand B | 150..157 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 163..168 | CDD:409353 | 0/4 (0%) | ||
Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
Ig strand E | 180..186 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 193..200 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 219..295 | CDD:404760 | 15/76 (20%) | ||
putative Ig strand A | 219..225 | CDD:409353 | 0/5 (0%) | ||
Ig strand B | 235..239 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 248..252 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 288..293 | CDD:409353 | 4/4 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |