DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:295 Identity:73/295 - (24%)
Similarity:108/295 - (36%) Gaps:81/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNATVQAGQHAYLPC 220
            |:.:.:||| .:.:||   |::|.||          |....||  .:.|..|.||..|:.|.:.|
  Fly    47 PTLAEIPSK-GKHTRL---DTQQTAQ----------EDSDFPR--FAEPIANVTVSVGRDALMAC 95

  Fly   221 KLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNS 285
            .:....|..::|||:..:.|:::.|.....::|                  :|.|          
  Fly    96 VVENLKGYKVAWVRVDTQTILSIHHNVISQNSR------------------ISLT---------- 132

  Fly   286 FAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLFVITPR--TELIGDR 348
                        .:...||.|.||.|...|.|||.||:.|:|..|.|..|.|:.|.  .|.:...
  Fly   133 ------------YNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSN 185

  Fly   349 QRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRN 413
            ...|:.|..:.|.|..||..|  .|:.|.|.|.                   :..:.|. ||...
  Fly   186 DMVVREGQNISLVCKARGYPE--PYVMWRREDG-------------------EEMLIGG-EHVNV 228

  Fly   414 TIGSLV-IPLVRKIHSGNYTCEPENSAAASMQLHV 447
            ..|.|: |..|.::|...|.|...|....|:...|
  Fly   229 VDGELLHITKVSRLHMAAYLCVASNGVPPSISKRV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 32/131 (24%)
Ig <298..338 CDD:299845 17/39 (44%)
IG_like 352..447 CDD:214653 23/95 (24%)
Ig 358..439 CDD:143165 20/81 (25%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 32/131 (24%)
IG_like 82..174 CDD:214653 33/131 (25%)
IG_like 184..267 CDD:214653 24/102 (24%)
IGc2 191..255 CDD:197706 21/85 (25%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.