DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and dpr14

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:286 Identity:64/286 - (22%)
Similarity:116/286 - (40%) Gaps:60/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LNATVQAGQHAYLPCKLNQHSGKPLSWVRLR--DEHIIAVDHTTFINDARFASLLQSTTLTTLVS 268
            ||.:.|.....||.|::|...||.:||:|.|  |..:|.....|:..|:|::...:...      
  Fly    82 LNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPN------ 140

  Fly   269 GGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKV 333
                                              .|.|.|::.|..|.|.||||:::.|.:...|
  Fly   141 ----------------------------------DWKLLIQFANERDEGPYECQVSSHPPLVLLV 171

  Fly   334 QLFVITPRTELIGDR-----QRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQ 393
            .|.:|.|..|::.:|     :::.||||.:||.|::........||.|..|.:.:..:....|  
  Fly   172 YLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGG-- 234

  Fly   394 SGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAIK 458
                ..:..::...     ..:..|.|....:..:|||||...|....::.:|||:||..|:...
  Fly   235 ----ISVKTDMLPG-----RALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQH 290

  Fly   459 STAARPHRLGHGYTSLHQWLIFLLVA 484
            :..:|  :..:..|.:..:|:::.::
  Fly   291 ANGSR--QKANASTMVVLFLVYVCIS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 31/132 (23%)
Ig <298..338 CDD:299845 13/39 (33%)
IG_like 352..447 CDD:214653 20/94 (21%)
Ig 358..439 CDD:143165 16/80 (20%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 27/119 (23%)
Ig 84..169 CDD:299845 27/124 (22%)
IG_like 191..279 CDD:214653 20/98 (20%)
Ig 201..274 CDD:143165 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.