| Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001284854.1 | Gene: | Fas2 / 31364 | FlyBaseID: | FBgn0000635 | Length: | 885 | Species: | Drosophila melanogaster |
| Alignment Length: | 325 | Identity: | 64/325 - (19%) |
|---|---|---|---|
| Similarity: | 96/325 - (29%) | Gaps: | 137/325 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 218 LPCKLNQHSGKP--------------LSWVRLRDEHIIAV---------------------DHTT 247
Fly 248 F--INDARFASLLQSTTLTTL----------VSGGALSTTATPVAALGNSFAHAV---------- 290
Fly 291 -PGGQ---------------ERGNSSSLSWTLQIKYVNLEDAGWYEC-------------QLATE 326
Fly 327 --PKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEA 389
Fly 390 SGAQSGWYTQIDRNIFGSTEHNRNTIGS------LVIPLVRKIHSGNYTCEPEN---SAAASMQL 445
Fly 446 445 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 41/206 (20%) |
| Ig | <298..338 | CDD:299845 | 12/54 (22%) | ||
| IG_like | 352..447 | CDD:214653 | 21/103 (20%) | ||
| Ig | 358..439 | CDD:143165 | 17/89 (19%) | ||
| Fas2 | NP_001284854.1 | IG_like | 39..133 | CDD:214653 | |
| IG_like | 144..226 | CDD:214653 | |||
| IGc2 | 152..209 | CDD:197706 | |||
| I-set | 230..319 | CDD:254352 | 16/83 (19%) | ||
| IGc2 | 243..309 | CDD:197706 | 10/65 (15%) | ||
| IG_like | 330..424 | CDD:214653 | 20/97 (21%) | ||
| IGc2 | 339..412 | CDD:197706 | 18/76 (24%) | ||
| Ig | 447..518 | CDD:143165 | 18/94 (19%) | ||
| fn3 | 534..611 | CDD:278470 | |||
| FN3 | 640..735 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||