DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:251 Identity:56/251 - (22%)
Similarity:83/251 - (33%) Gaps:70/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARF-ASLLQSTTLTTLVSGG 270
            |.:|..|:.|...|.:....|..:.|::...:.|.|:......::.|. .|.|...|        
  Fly    50 NVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNT-------- 106

  Fly   271 ALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQL 335
                                             |.|.||.|:.||.|.|.|||.|:|..|....|
  Fly   107 ---------------------------------WNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFL 138

  Fly   336 FVITPRTELIGDRQR--FVKAGSRVELHCIVRGTLEAPKYIFWYR--GDQQVTAENEASGAQSGW 396
            .|:.|...:..|...  .|..||.|.|.|..||..|  ..:.|.|  |::.|..:|..:...:  
  Fly   139 DVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPE--PIVTWRREDGNEIVLKDNVGTKTLA-- 199

  Fly   397 YTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTC------EPENSAAASMQLH 446
             ......:...::.:||.:||             |.|      .|..|...|:.:|
  Fly   200 -PSFRGEVLKLSKISRNEMGS-------------YLCIASNGVPPSVSKRISLSIH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 29/130 (22%)
Ig <298..338 CDD:299845 16/39 (41%)
IG_like 352..447 CDD:214653 24/103 (23%)
Ig 358..439 CDD:143165 18/88 (20%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 25/119 (21%)
Ig 51..131 CDD:299845 25/120 (21%)
I-set 144..240 CDD:254352 24/113 (21%)
IGc2 159..228 CDD:197706 19/86 (22%)
Ig 244..337 CDD:299845
I-set 244..337 CDD:254352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.