DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:299 Identity:74/299 - (24%)
Similarity:99/299 - (33%) Gaps:84/299 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 LPRRQ--LSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLL 258
            ||..|  .|..|.:.||.||..|.|||.|..:|| .:.|                          
  Rat    48 LPGTQTRFSQEPADQTVVAGHRAVLPCVLLNYSG-IVQW-------------------------- 85

  Fly   259 QSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQL 323
               |...|..|......|.|        .:.|.|..:.|     .:.|:|....|.|...|||| 
  Rat    86 ---TKDGLALGMGQGLKAWP--------RYRVVGSADAG-----QYNLEITDAELSDDASYECQ- 133

  Fly   324 ATEPKM-SAKVQLFVITP--RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTA 385
            |||..: |.:.:|.|:.|  .|.:.|.....::||:...|.|.......|.. |.|:|...|   
  Rat   134 ATEAALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPYNLTCRAFNAKPAAT-IIWFRDGTQ--- 194

  Fly   386 ENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSA-------AASM 443
                   |.|..|..:....|..|   .||..|:|..........:||...|.|       :..:
  Rat   195 -------QEGAVTSTELLKDGKRE---TTISQLLIQPTDLDIGRVFTCRSMNEAIPNGKETSIEL 249

  Fly   444 QLH-------------VLSGEYSASAIKSTAARPHRLGH 469
            .:|             ||.||......::| |.|..||:
  Rat   250 DVHHPPTVTLSIEPQTVLEGERVIFTCQAT-ANPEILGY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 34/132 (26%)
Ig <298..338 CDD:299845 13/40 (33%)
IG_like 352..447 CDD:214653 23/114 (20%)
Ig 358..439 CDD:143165 19/80 (24%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 35/137 (26%)
Ig 57..148 CDD:299845 34/134 (25%)
Ig2_KIRREL3-like 170..251 CDD:143236 20/94 (21%)
I-set 255..336 CDD:254352 9/34 (26%)
Ig_2 259..337 CDD:290606 9/30 (30%)
Ig_2 340..437 CDD:290606
IG_like 346..437 CDD:214653
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.