Sequence 1: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_218634.5 | Gene: | Iglon5 / 308557 | RGDID: | 1305344 | Length: | 336 | Species: | Rattus norvegicus |
Alignment Length: | 322 | Identity: | 74/322 - (22%) |
---|---|---|---|
Similarity: | 118/322 - (36%) | Gaps: | 93/322 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 200 QLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQS---- 260
Fly 261 TTLTTLVSGG-------ALSTTATPVAALGNSFAHAVPGG----------QERGN---------- 298
Fly 299 -SSSLSW------------TLQIKYVNLEDAGWYEC----QLATEPKMSAKVQLFVITPR--TEL 344
Fly 345 IGDRQRFVKAGSRVELHCIVRGTLEA----PKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIF 405
Fly 406 GSTEHNRNTIGSLVIPLVRKIHSGNYTCEPEN---SAAASMQLHVLSGEYSASAIKSTAARP 464 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 37/179 (21%) |
Ig | <298..338 | CDD:299845 | 12/66 (18%) | ||
IG_like | 352..447 | CDD:214653 | 28/101 (28%) | ||
Ig | 358..439 | CDD:143165 | 23/87 (26%) | ||
Iglon5 | XP_218634.5 | Ig | 41..129 | CDD:416386 | 20/90 (22%) |
Ig strand A' | 41..46 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
FR2 | 61..68 | CDD:409353 | 2/9 (22%) | ||
Ig strand C | 61..67 | CDD:409353 | 1/8 (13%) | ||
CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 7/34 (21%) | ||
Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 107..115 | CDD:409353 | 0/7 (0%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
FR4 | 122..129 | CDD:409353 | 0/6 (0%) | ||
Ig strand A | 132..137 | CDD:409353 | 1/4 (25%) | ||
Ig_3 | 134..199 | CDD:404760 | 11/64 (17%) | ||
Ig strand A' | 140..145 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 148..157 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 163..167 | CDD:409353 | 0/3 (0%) | ||
Ig strand D | 174..177 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand F | 191..199 | CDD:409353 | 4/7 (57%) | ||
Ig_3 | 217..295 | CDD:404760 | 26/102 (25%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 234..238 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 288..293 | CDD:409353 | 4/4 (100%) | ||
Ig strand G | 301..304 | CDD:409353 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |