DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr16 and Lsamp

DIOPT Version :9

Sequence 1:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:388 Identity:76/388 - (19%)
Similarity:122/388 - (31%) Gaps:137/388 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PPADIGPSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNATVQAGQ 214
            |||::..|...:|..|     :.:.|..:...                         |.||:.|.
  Rat    30 PPAEVNLSPITIPGLP-----VRSVDFNRGTD-------------------------NITVRQGD 64

  Fly   215 HAYLPCKLNQHSGKPLSW-------------------VRLRDEHI----IAVDHTTFINDARFAS 256
            .|.|.|.:...:.| ::|                   |.|...|.    :.:......::..:..
  Rat    65 TAILRCVVEDKNSK-VAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTC 128

  Fly   257 LLQ---------------------------------STTLTTLVSGGALSTTATPVAALGNSFAH 288
            .:|                                 :.||..:.:|     ...||.    ::.|
  Rat   129 SVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANG-----RPEPVI----TWRH 184

  Fly   289 AVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLFVIT---PRTELIGDRQR 350
            ..|.|:|.......   |:|..:..|.:|.|||:.|.|.. ||.|:...:|   |.| :...:..
  Rat   185 LTPLGREFEGEEEY---LEILGITREQSGKYECKAANEVS-SADVKQVKVTVNYPPT-ITESKSN 244

  Fly   351 FVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTI 415
            ....|.:..|.| ....:.||.: .|||.|.::   |.|:|.:           ..|||..    
  Rat   245 EATTGRQASLKC-EASAVPAPDF-EWYRDDTRI---NSANGLE-----------IKSTEGQ---- 289

  Fly   416 GSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAI---KSTAARPHRLGHGYTSLH 475
            .||.:..|.:.|.|||||...|..          |..:||.:   :.....||.:....|::|
  Rat   290 SSLTVTNVTEEHYGNYTCVAANKL----------GVTNASLVLFKRVLPTVPHPIQEIGTTVH 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 34/187 (18%)
Ig <298..338 CDD:299845 12/39 (31%)
IG_like 352..447 CDD:214653 25/94 (27%)
Ig 358..439 CDD:143165 24/80 (30%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 13/115 (11%)
FR1 55..71 CDD:409353 6/40 (15%)
Ig strand A' 56..62 CDD:409353 3/30 (10%)
Ig strand B 64..72 CDD:409353 3/7 (43%)
CDR1 72..76 CDD:409353 0/3 (0%)
FR2 77..84 CDD:409353 2/7 (29%)
Ig strand C 77..83 CDD:409353 2/6 (33%)
CDR2 85..95 CDD:409353 0/9 (0%)
Ig strand C' 87..90 CDD:409353 0/2 (0%)
Ig strand C' 92..95 CDD:409353 0/2 (0%)
FR3 96..131 CDD:409353 3/34 (9%)
Ig strand D 100..107 CDD:409353 2/6 (33%)
Ig strand E 110..116 CDD:409353 0/5 (0%)
Ig strand F 123..131 CDD:409353 0/7 (0%)
CDR3 132..136 CDD:409353 0/3 (0%)
Ig strand G 136..145 CDD:409353 0/8 (0%)
FR4 138..145 CDD:409353 0/6 (0%)
Ig_3 148..218 CDD:404760 16/81 (20%)
Ig strand A' 155..160 CDD:409353 0/4 (0%)
Ig strand B 166..173 CDD:409353 2/6 (33%)
Ig strand C 179..184 CDD:409353 1/8 (13%)
Ig strand D 190..193 CDD:409353 1/2 (50%)
Ig strand E 197..203 CDD:409353 2/8 (25%)
Ig strand F 210..217 CDD:409353 4/6 (67%)
Ig strand G 224..232 CDD:409353 1/7 (14%)
Ig_3 235..311 CDD:404760 26/96 (27%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 265..269 CDD:409353 0/4 (0%)
Ig strand E 290..294 CDD:409353 2/3 (67%)
Ig strand F 304..309 CDD:409353 4/4 (100%)
Ig strand G 318..321 CDD:409353 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.